KEGG   Caenorhabditis briggsae: CBG23394Help
Entry
CBG23394          CDS       T01054                                 

Definition
Hypothetical protein CBG23394
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CBG23394
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     CBG23394
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     CBG23394
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V
AA seq 717 aa AA seqDB search
MTYLTLTRGISTRLLKGAALQPNRASFRKMSIDNSTCPPINIRRCSCTSEGFSPKKSITS
PIWDRRPSKILDENHLPKQLLVQHHHEDGAFLRNISATELVLEVDETAGTQQIGAPSALP
ESRVLVLYTGGTIGMKTTDGVYCPVPGYLPEVLRDIPPLNDRRYIEESYSNVAVRPYSLP
PVRHMKKRVVYWIVEYEPLLDSCDMTFDDWIRIATDIKKAYHKYDGFVVLHGTDTLAYTA
SALSFMMENLGKPVIITGSQIPVAEVRSDGMENLIGALITAGNFDIPEVCVYFNNKLMRG
NRTVKLDNSALEAFDSPNMSPLAQMAINIKVNYDSIFRSDMVAAFTVHENLCRDVGMLRI
FPSMTIESVRAFLQPPTRGVILQTFGSGNMPTRRQDIILALKDAIARGVMVVNCSQCLKG
QVDVNYATGKILYDIGVIPGSDMTSEAAMAKLCYVLGKDEWDLPMKRSMLQANLRGEMTV
ATKGAMRELDIIPHIAKCLRVSSSQEVQLLRDIILPPMFCNAAKTNDVEILKSLKAAGVN
FSATDYNLRTALHVAASNGNIESVNYLLKIGTNVHIKDMFGYNALVCAVKAKAMDCVVAI
RGAGGFIDASSQKIGVELCLAVYQNDIELLKCNEAAGTHMGEKDYDNRTALHVAASLNKP
EIVTYLLQCGLNPYEKDDFGITPIDEARRRNLQSIVDLMENNYHPAPENGDGVFHME
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgacctacttgacactaacccgcggaatttccacgcggttattgaaaggggcagccctt
caacccaaccgtgcttcattccggaagatgtccatcgataattcgacctgtccaccaatt
aatatcagaagatgttcatgtaccagtgaaggattttctccgaaaaaatcaattacatcg
ccgatctgggaccgtcggccttcgaaaatacttgatgagaaccatctaccgaagcaactt
cttgtacaacatcaccacgaggatggcgcatttcttcgaaatatttcagcgacggaactt
gtacttgaagtcgatgaaacagctggtactcaacaaatcggtgctccatctgcattaccg
gaatctcgagttctagtcctctacactggtggaacgattggaatgaaaactacagatgga
gtatactgcccagttcctggatatctccctgaagttctccgcgacattccaccattgaat
gatcgtcggtacatcgaagaaagctactcgaatgtggctgttcgtccctattcattgcca
ccagtccggcacatgaaaaaacgcgttgtctattggattgtggaatatgaaccacttctc
gattcttgtgacatgacatttgacgactggattcgtatagccactgacatcaaaaaagcc
tatcacaaatacgacggatttgttgttcttcacggaacagacaccctcgcttacactgca
agtgcactatcattcatgatggaaaaccttggaaagccggttattatcacaggaagtcag
attccagtcgcagaagttcgatccgatggtatggagaatctgattggagcattgatcact
gctggtaactttgacattccggaagtctgtgtttatttcaataacaaactgatgcgtgga
aatcgaacagtcaaactggataattcagcacttgaagcattcgatagtccgaatatgtca
ccattggcacaaatggctataaatatcaaagttaactacgattcaatcttccgaagtgat
atggttgccgcattcacagttcatgaaaacctttgccgtgatgttggaatgcttcgaatc
ttcccatcaatgaccattgaatcagttcgcgccttccttcaaccaccaaccagaggtgtc
attcttcaaacttttggatcaggaaacatgccaacacgacgacaagacattattttggca
ctcaaggatgctatagcgcgcggtgtgatggtcgttaactgttcccaatgtctgaaagga
caggtcgatgtgaactacgccacaggcaagattctatatgacatcggagtcattccggga
tccgatatgacgtcagaagcagctatggccaaattgtgttatgtattgggaaaagacgag
tgggatctgccaatgaagaggagtatgcttcaagcaaaccttcgtggagagatgactgtt
gcaactaaaggagctatgcgagagcttgatatcattccacacattgccaaatgcctgcgg
gtttcatcttctcaagaagttcaacttctccgtgatatcatcctcccaccaatgttctgt
aatgctgccaaaacgaatgatgttgagattctgaaatctttgaaagcagctggagtgaat
ttctctgccactgactacaatctccgaactgctcttcacgttgctgcttcgaatggaaac
atcgaatcggttaattatttgctcaaaataggaaccaatgtgcatattaaagatatgttc
ggctacaacgctcttgtatgtgcagtgaaagcgaaagcgatggattgtgtcgtggcgatt
cgaggagctggtggtttcatagatgcctcgtctcagaaaatcggcgttgaactttgtttg
gctgtgtaccagaatgacatcgaacttctgaagtgcaacgaagcagccggaactcacatg
ggcgagaaagattacgataatcgcacggcgttacatgtggctgcgtctctcaacaaacca
gaaattgtcacttatcttctccaatgtggtctgaacccgtacgagaaagatgacttcgga
atcacaccaattgacgaagcccggcgacgaaatttgcagagtattgtggatttaatggaa
aacaactaccacccagcgcccgaaaacggagatggagtgtttcatatggaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system