KEGG   Caenorhabditis briggsae: CBG23399Help
Entry
CBG23399          CDS       T01054                                 

Gene name
Cbr-elpc-3
Definition
C. briggsae CBR-ELPC-3 protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
cbr  Caenorhabditis briggsae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V
AA seq 548 aa AA seqDB search
MDDKGSQRALLAQTVNEIVKLLIEAHNQKKDVNLNRLKCIVAQKNGLSFQPKLVDIIAGV
PADYKDTLLPKLKAKPVRTASGIAVVAVMSKPHRCPHINFTGNICVYCPGGPDSDFEYST
QSYTGYEPTSMRAIRARYNPYLQTRGRLNQLMQLGHSVDKVEFIVMGGTFMSLPEDYRDF
FIRNLHDALSGHTSASVEEAVAYSERSKMKCIGITIETRPDYCLPRHLNDMLLYGCTRLE
IGVQSTYEDVARDTNRGHTVKSVCETFHMAKDTGYKVVIHMMPDLPNVGLERDKEQFLEL
FESPAFRPDGLKLYPTLVIRGTGLYELWKTGRYQSYPPSVLVDLIATILSLVPPWTRVYR
VQRDIPMPLVSSGVEHGNLREHAMAKMKELGLKCRDVRTREVGIQEIHNKVRPEDVELIR
RDYTANGGWETFISYEDPKQDILIGLLRLRKISDKAHRAELKGNVSVVRELHVYGSVVSV
ADRDPKKFQHQGYGSLLMEEAERIAREEHESDKIAVISGVGTRDYYRKLGYELDGPYMSK
TLDASSAA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggacgacaaaggttcacagcgagcattgctggctcaaacggtcaatgaaatcgtcaaa
cttcttattgaagctcataaccagaaaaaagatgtgaacttgaatcggctaaaatgtatt
gttgcacagaaaaatggactcagcttccaaccaaaactggtagatatcattgctggagtt
ccagcggactacaaggatactcttctaccaaaacttaaggcaaaaccagttcgaacagct
tctggaatcgcagttgttgcagtgatgagcaaaccacatcgttgtccgcatatcaatttc
actggaaacatttgcgtttattgtccaggaggcccagattctgactttgagtactctaca
caaagttatactggttacgagccaacaagcatgagagccatccgagcaagatataatccg
tatttgcaaacacgtggaagattgaatcagttgatgcaactaggtcattctgtcgacaag
gtcgagttcatcgtgatgggaggaacattcatgtcactaccagaggattaccgagatttc
tttattcgcaatctccatgatgctctcagtggacatacttctgcttcagttgaagaagcg
gttgcctactccgagagatccaaaatgaagtgcattggaattaccattgaaaccaggcca
gactactgtctcccacgtcatctgaatgatatgcttctgtacggatgtacacgcctggaa
atcggtgttcagtcaacatatgaagacgtggcaagggatacaaatcgaggtcataccgtt
aaatcagtttgtgaaaccttccatatggcaaaagacactggatacaaagttgtaatccac
atgatgcctgatttacctaatgttggattggaaagagacaaagagcaatttttggagttg
tttgaaagtccagcattccgtccggatggcttgaaactttatccaacgttagtgattcgt
ggaacaggattgtacgagctgtggaaaactggaagatatcaaagttatccaccatcagtg
cttgttgatctaatcgcaactattctatcattggttcctccatggacgcgtgtttatcgt
gtgcaaagagacattccaatgccattggtttcatcaggtgttgaacatggaaatctccga
gagcatgcaatggcaaagatgaaggagcttggattgaaatgtcgggatgttcgaacaaga
gaagttggaattcaggaaattcacaacaaagttcgccccgaagacgtcgaattgatccga
agagattatacggctaacggtggatgggagacattcatttcgtatgaagatccaaaacaa
gatattctcattggattgcttcgattgagaaaaatctctgataaagctcatagagcagag
ttgaagggtaatgtgtctgtagtccgtgagcttcacgtatatggatcagttgtctcggta
gccgaccgggatcccaagaagttccaacaccaaggatacggatcactgttgatggaagaa
gctgaaaggatagcaagagaagaacatgaatcagataagattgcagtcatctcgggagtt
ggaacccgcgactactaccgcaagcttggttatgaattggatggtccctacatgagcaag
actcttgatgcttcgtcagccgcataa

DBGET integrated database retrieval system