KEGG   Caenorhabditis briggsae: CBG23437Help
Entry
CBG23437          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG23437
  KO
K11252  histone H2B
Organism
cbr  Caenorhabditis briggsae
Brite
Chromosome and associated proteins [BR:cbr03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    CBG23437
Exosome [BR:cbr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CBG23437
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like CENP-W DUF1931
Motif
Other DBs
NCBI-GeneID: 8578714
NCBI-ProteinID: XP_002636718
WormBase: CBG23437
UniProt: G2J6I6
Position
V
AA seq 122 aa AA seqDB search
MPPKPSAKGAKKAAKTVTKPKDGKKRRAHRKESYSVYIYRVLKQVHPDTGVSSKAMSIMN
SFVNDVFERIAAEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTS
SK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaagccatccgccaagggagccaagaaggccgccaagaccgtcaccaagcca
aaggacggaaagaaaagaagagcccaccgcaaggaatcctactctgtgtacatctaccgt
gtgctcaagcaggtccatccagacactggtgtctcttccaaggccatgtcaatcatgaac
tctttcgtcaatgatgtctttgagcgcatcgccgccgaagcttctcgtcttgctcactac
aacaagagatcgaccatctcatcccgcgaaattcaaaccgctgttcgtttgatccttcca
ggagagctcgccaagcacgccgtgtctgagggaaccaaggctgttaccaagtacacctcc
agcaagtaa

DBGET integrated database retrieval system