KEGG   Caenorhabditis briggsae: CBG23724Help
Entry
CBG23724          CDS       T01054                                 

Definition
Hypothetical protein CBG23724
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
cbr  Caenorhabditis briggsae
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cbr00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cbr00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:cbr00471]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
I
AA seq 577 aa AA seqDB search
MAFLKPLDPNKRAFSGLLFDTKRNRKMMEYDFYRVNTVISDVKVCRSMSYDMCGNHQQEL
LFDLYKDETTGKVYLPRFFKALLESGIRKDDPRIDKMIQNIKDADLLDDFVWGSQHIYLE
KDTFKKYIGSSIGVVTKALKKQMIIPDWERFVGDMGEIFEDVRGFNEGELATYIPQLSRV
PPDSWAMSVCTIDGQRKSWGDSLNPFCLQSVSKPFTYALVHDDIGPEALHAHVGQEPSGR
LFNDISLDHNKKPHNPLINAGAIVVASLLKNKTPLADRFDFMIHACRKFVGSGYIGFNNS
VFLSERETADRNYALSYYMREHNVFPKDLNLQDTLDLYFQICSIETNCDSLAVMAATLAN
GGVNPMNGERVVNNRACRDTLSLMYSCGMYDWSGQFAFHVGLPAKSGVSGDMIIVIPNVM
GIALYSPRLDKLGNTVRGVKFAEQLVQKYNFHNYDSLIYSDNKKIDPRRQLKDDHDGQNR
FMYATKLGDIAAIKRFLLMGHDIHCKDYDNRTVLHVAAAEGDVVTLEYVLSKWQEDPDPL
DRYDRTPLDDAKHFNHTACIKLLEEAITVFNLKQQDD
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggcctttttgaagccgctcgacccgaacaaaagggctttttctggattactttttgac
acaaagcggaatagaaaaatgatggaatacgacttttaccgagtgaacactgtgataagt
gatgtaaaagtgtgtcgttcgatgtcgtacgatatgtgtggaaatcatcagcaagagctg
ctcttcgatctttacaaggatgagacgacaggaaaagtctatcttccacgatttttcaag
gctttgcttgaaagcggaatccgaaaagacgatcctcgaatcgacaaaatgattcaaaac
attaaagatgctgatcttctggatgattttgtatggggctcccaacacatttatttggaa
aaggacacattcaagaaatacattggaagtagcattggagtggtgacgaaggcattgaag
aagcagatgatcataccggattgggaacggttcgttggagatatgggagagatttttgaa
gatgttcgaggattcaatgaaggagaactggcaacgtatattccacaactatcacgagtt
ccacctgatagttgggcaatgtctgtatgtacgattgatgggcaaaggaagagctgggga
gactcattgaatccgttctgtctgcaaagtgtttcaaaacccttcacttatgctctggtt
catgatgatattggaccggaggcgttgcatgcacacgtgggacaagaaccttctggaaga
ctattcaacgatatcagtttagatcataataaaaaaccccacaatccactaatcaacgct
ggtgcgatcgtcgttgcttcgctgctcaaaaacaagactccactggcagatcgcttcgat
tttatgatccacgcgtgccggaaattcgtcggaagtggatacattggattcaacaactcg
gtatttttgtctgaaagagaaacggctgatcgaaattatgctctatcgtactacatgagg
gaacacaacgtctttccgaaagatttgaatctccaagacactcttgatctctacttccaa
atttgttccatcgagaccaactgtgattcattggctgtaatggctgccacgttggcgaat
ggtggagtgaatccgatgaatggtgaacgggttgtgaataatcgtgcgtgccgagacaca
ctttctctgatgtactcatgtggaatgtacgattggtcgggtcagtttgcattccatgtt
ggtctccctgcaaagtctggagtatctggagatatgataattgtgataccaaatgtgatg
ggcattgcattgtacagtccacgactagacaaattgggaaatacggttagaggagtgaag
tttgcggagcagttggtacagaagtataatttccacaattatgatagtttgatttactcg
gacaacaaaaagattgatccccgtcggcaactgaaagacgatcatgatggtcagaataga
tttatgtatgccacaaaattgggagacattgctgcaatcaaacgattcctactgatggga
cacgatattcattgcaaagattacgataacagaacagttttacacgtggcagctgccgaa
ggagacgtcgttacattggaatacgttctgagcaaatggcaggaagatcctgatccactt
gatagatacgatcgaactcctttggatgatgcgaaacattttaaccacacggcgtgtatc
aaacttctcgaagaggcaattactgttttcaatctcaagcaacaggatgattag

DBGET integrated database retrieval system