KEGG   Caenorhabditis briggsae: CBG23928Help
Entry
CBG23928          CDS       T01054                                 

Definition
Hypothetical protein CBG23928
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CBG23928
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
AA seq 441 aa AA seqDB search
MFLAIVGIVYILLVPEETEAINPPTAVLDLSDKFLDVKDEGMWFVEFYAPWCAHCKRLHP
VWDQVGHSLSDSNLQIRVGKLDCTRFPAVANKLGIQGYPTITFFRNGHAIEYRGGREKEA
LVSFAKRCAAPIIETIKENQVEKVKLSARSQPSYIFFGHSSGPLFDAFNEAANAKFSVAR
FYTVAPSKEETNFRQRVVVLKDNVEIEFQEDIEALKDWVVRERWPTFVHATSSNLAELGA
SGKLVVLIVSSESQKFNTTSPVREFHKVAEDASKEMRKHSALWNRFQFAWLDGSDLASQI
QMASVSEPHLFVFNYTSYEYYLSEDEPSQMTIKSIFTFLEQTAEGIDKGTIIAFGGRNLL
TRMKRMIFELYWNIAQMFATQPLLSSCLFGVPIAFLSIICYSICSADFTVDRDEFYGDEA
LEDEEEETDTIETDDDHEKAE
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgtttctagccattgtgggcattgtctatatcttgttagtgcctgaagaaacagaagct
atcaatcctcccacggccgttcttgatttgagcgacaaatttttggatgtcaaagatgaa
ggaatgtggtttgttgaattctatgctccgtggtgtgcacattgcaaaagattacatccc
gtgtgggatcaagttggacactccttgtcagatagcaaccttcaaatcagggtcggtaaa
ctcgattgcacacgattccctgctgtcgccaacaaacttggtatccagggatatccaact
atcactttctttcgaaatggacatgctattgaatacagaggcggaagagaaaaagaggca
ttggtcagttttgcgaagagatgcgcagctccaattatagagactatcaaagaaaaccaa
gtggaaaaggtgaaactatctgcacgttctcaaccatcctacatctttttcggccattct
tcgggtccattgtttgatgcttttaacgaagcagccaatgcgaaattttcagttgctaga
ttttacacagtagctccttccaaagaagaaacaaatttccgccaaagagtggttgttttg
aaagataacgttgaaattgagttccaagaagacattgaagcattgaaagattgggttgtc
agagagcgatggccaacctttgtccacgcgacatcatcaaaccttgctgaactcggtgca
agtgggaaacttgttgttctcattgtatccagtgagagtcagaagttcaatacaaccagc
ccggttcgcgaatttcataaagttgctgaagatgcatcaaaggaaatgaggaaacactcg
gcgctttggaatcgattccagtttgcatggcttgatggttcagaccttgcctctcaaatt
caaatggcctctgtttccgaaccccacttgtttgtattcaactacacgagctatgagtac
tatctcagcgaagatgaaccaagccaaatgacaattaaatcaatttttactttcttggag
caaactgctgaaggaatagataagggtacaattattgccttcggaggccgtaatttattg
actcggatgaagagaatgattttcgaattatactggaatattgcacaaatgtttgctact
cagccattgctatcttcctgtcttttcggagttcctattgcttttctcagcatcatttgt
tatagcatctgttctgccgatttcactgtcgatcgcgatgaattctatggcgacgaagca
ctcgaagatgaggaagaggaaactgacacaatagaaacggatgacgatcatgagaaagcc
gaataa

DBGET integrated database retrieval system