KEGG   Caenorhabditis briggsae: CBG23998Help
Entry
CBG23998          CDS       T01054                                 

Gene name
Cbr-mbk-2
Definition
C. briggsae CBR-MBK-2 protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CBG23998 (Cbr-mbk-2)
Protein kinases [BR:cbr01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   CBG23998 (Cbr-mbk-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
AA seq 523 aa AA seqDB search
MTLFEPSTSGIRLGYRGSSNSSSGVGSGGSGSLMTQSIGGPNKHLSASHSTLNTASTHDS
MMHTKIPKSPSNESLSRSHTSSSGGSQGGHNSNSGSNSGFRPEDAVQTFGAKLVPYEKNE
IYNYTRVFFVGSHAKKQPGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFG
QVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFR
NHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENV
LLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAE
LLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGS
VVLAGARSKRGKMRGPPESRSWSTALKNMGDELFVDFLKRCLDWDPETRMTPAQALKHKW
LRRRLPNPPRDGMDSMGGLADHDKKADLPNIDSNANILMRKKF
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgacactttttgagccgtctacatcgggtattcgactggggtacagaggctcgtccaat
tcgtcatctggcgttggatcgggaggatctggaagtctaatgacgcagtcgatcggtggg
cccaataaacatttgtcagcatcgcactccacactcaatactgcttcaacacacgattcc
atgatgcacaccaaaatcccaaagagtccaagcaatgagagtttaagccgatcacacact
tcctcatctggaggcagtcaaggtggacataattcgaactctggatccaactcaggattc
cgaccggaagatgctgtacagacgttcggtgcaaaattagtaccgtacgagaaaaacgag
atttacaactacacgcgggttttctttgttggatcacacgcgaagaaacagccaggagtg
atcggaggagctaataatggtggatatgatgatgaaaatgggtcatatcaacttgtcgtt
catgatcacattgcctatcgttacgaagttctcaaagtaattggaaaaggctcctttgga
caggttatcaaagcattcgatcataaatatcagcaatatgtggcattgaagttagtacgc
aatgagaagcgtttccatcgtcaagccgacgaagaaatcagaatattggatcatcttcga
cgacaagattctgatggaacgcacaatattattcatatgctcgactacttcaatttccga
aatcacaagtgcattacgtttgagctcctcagtatcaacctttacgagttgataaagaga
aacaagttccaaggattctcactgatgcttgtgagaaaattcgcttactctatgctcttg
tgtctggatcttctacaaaagaacagattgatacattgtgatttgaaaccagaaaatgtg
cttttgaagcagcaaggaagaagtggaattaaggtcatcgattttggatcttcatgtttc
gacgatcaacgcatatacacctacattcaatcacgcttctacagagctccagaagtgatt
cttggaaccaaatacggaatgcccattgatatgtggtctcttggatgtatacttgctgaa
cttctcaccggatacccattgttgccaggagaggatgagaatgatcaactagctcttatc
atcgagttgctcggaatgccaccaccgaaaagtttggaaacagcgaaacgtgcacgcact
ttcattacttcgaaaggatacccacgatactgtacagcgacatcaatgccagacgggtct
gtcgtactcgctggcgccaggtcgaagagaggaaagatgcgtggaccaccagaatcgcga
tcatggtcgacggcattgaagaacatgggagacgagttgtttgtcgatttcctgaaacgg
tgtctcgactgggatccagagactcgaatgactccagctcaagctttgaagcacaaatgg
ctccgtcgcaggttaccgaatccaccaagagatggtatggattcaatgggaggactcgca
gatcacgataaaaaagcggatttgccaaacattgactcgaatgccaatattttgatgcgg
aaaaagttttga

DBGET integrated database retrieval system