KEGG   Caenorhabditis briggsae: CBG24154Help
Entry
CBG24154          CDS       T01054                                 

Definition
Hypothetical protein CBG24154
Orthology
K03941  
NADH dehydrogenase (ubiquinone) Fe-S protein 8 [EC:1.6.5.3 1.6.99.3]
Organism
cbr  Caenorhabditis briggsae
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:cbr00190]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III
AA seq 212 aa AA seqDB search
MALKSVAVLTKGMFGRMPAQLAISSVPSNTIQRRSNYKFVGMPNETDGTVAGDLNYGLHT
VFFTELFRGFGVMLGHVFMEPATINYPFEKGPLSSRFRGEHALRRYPSGEERCIACKLCE
AICPAQAITIEAETRPDGSRRTTRYDIDMTKCIYCGLCQEACPVDAIVEGPNFEYSTETH
EELLYNKEKLLLNGDRWEPELASNLQAEYLYR
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaaaagtgtggcagtgctgacaaaaggcatgttcggaagaatgccggcccag
ctcgccatcagcagtgtcccatcaaataccatccaaagacgatccaactataaattcgtc
ggaatgcccaatgagaccgacggaaccgtggcaggcgatttgaactatggtcttcacacc
gttttcttcaccgagcttttccgaggatttggagtgatgcttggtcacgtcttcatggag
ccagccaccatcaattaccctttcgaaaagggacctctcagctcgagattcagaggagag
cacgcccttcgtcgttatccatctggagaggaacgttgcatcgcctgcaaattgtgcgaa
gctatttgccccgctcaagcgatcaccatcgaagcagagacccgtccagatggttcccgt
cgtacaactcgttatgatatcgacatgactaagtgtatctattgtggactttgtcaagag
gcttgtccagttgacgctattgtcgaaggaccaaatttcgagtattctactgaaactcac
gaagaattgctctataataaggagaaacttcttctgaatggagatcgttgggaaccggaa
ttggcatcgaatcttcaggctgaatatctctatcgctaa

DBGET integrated database retrieval system