KEGG   Caenorhabditis briggsae: CBG24154Help
Entry
CBG24154          CDS       T01054                                 

Definition
Hypothetical protein CBG24154
Orthology
K03941  
NADH dehydrogenase (ubiquinone) Fe-S protein 8 [EC:1.6.5.3 1.6.99.3]
Organism
cbr  Caenorhabditis briggsae
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    CBG24154
Enzymes [BR:cbr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     CBG24154
   1.6.99  With other, unknown, acceptors
    1.6.99.3  NADH dehydrogenase
     CBG24154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III
AA seq 212 aa AA seqDB search
MALKSVAVLTKGMFGRMPAQLAISSVPSNTIQRRSNYKFVGMPNETDGTVAGDLNYGLHT
VFFTELFRGFGVMLGHVFMEPATINYPFEKGPLSSRFRGEHALRRYPSGEERCIACKLCE
AICPAQAITIEAETRPDGSRRTTRYDIDMTKCIYCGLCQEACPVDAIVEGPNFEYSTETH
EELLYNKEKLLLNGDRWEPELASNLQAEYLYR
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaaaagtgtggcagtgctgacaaaaggcatgttcggaagaatgccggcccag
ctcgccatcagcagtgtcccatcaaataccatccaaagacgatccaactataaattcgtc
ggaatgcccaatgagaccgacggaaccgtggcaggcgatttgaactatggtcttcacacc
gttttcttcaccgagcttttccgaggatttggagtgatgcttggtcacgtcttcatggag
ccagccaccatcaattaccctttcgaaaagggacctctcagctcgagattcagaggagag
cacgcccttcgtcgttatccatctggagaggaacgttgcatcgcctgcaaattgtgcgaa
gctatttgccccgctcaagcgatcaccatcgaagcagagacccgtccagatggttcccgt
cgtacaactcgttatgatatcgacatgactaagtgtatctattgtggactttgtcaagag
gcttgtccagttgacgctattgtcgaaggaccaaatttcgagtattctactgaaactcac
gaagaattgctctataataaggagaaacttcttctgaatggagatcgttgggaaccggaa
ttggcatcgaatcttcaggctgaatatctctatcgctaa

DBGET integrated database retrieval system