KEGG   Caenorhabditis briggsae: CBG24573Help
Entry
CBG24573          CDS       T01054                                 

Gene name
Cbr-sos-1
Definition
C. briggsae CBR-SOS-1 protein
Orthology
K03099  
son of sevenless
Organism
cbr  Caenorhabditis briggsae
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:cbr04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:cbr04012]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:cbr04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:cbr04068]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:cbr04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
V
AA seq 577 aa AA seqDB search
MSISAADTVSLTSRRTISTSKHWAAIFDERIYQICNIAHPGLPIDFDAVEHIRYFLQSIV
FELIETRATSVAEVDKTAEKLFGYGLNTICKDAWDNMHQQLQHKHKYQKTLKTALESQHR
LAAVIKGLDTKSWKIGFLAEFEEFVAEETEHAAAAAATSSNRQTYESVAVDFLRDERRFI
RELNRINVFRRRIESIATSESDKTIVANLFGNLHEIHDLALKIERTLEDAIELNDTQCIG
MGIWEYGEAYEFDTYTFYIKRDGSEMNESRHATYVINDTIKALLESERFSKLFMKSGEHS
SSLDGQSFRLAVQYVLPQLLHIPIFHIYQYHEYINRLHQLSSSEEDRRDLNDCRAAFERV
VGSVSDIPPELKTRIASFLDQQAKSEKIYNVKRLNEIQTSIDGFVGSPIGKMCNELEADG
DLGMIRPSLQLTSDITKNKKWKTERFVYVFDQLIILCKRHKNSLKFKDRLPVHSIDVFDV
PDSEVLNCFGIESHDKSSLPKTYHFVCRNPEEKRQWMAVLVKVTTKSVLDRILDNYEKEE
AKRIPLIVPGPDQYRFSEPDTESNITFEDYTSSSGIP
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgagcatctccgctgctgacactgtgtcgttgacgagtcgacgaaccatctcgaccagc
aagcattgggcggcgattttcgatgagagaatttatcagatctgcaacattgctcatcct
ggcctccccattgacttcgatgccgtcgaacacatccgttattttcttcagagtatcgtc
tttgagctcatcgagacacgtgccacaagtgtcgccgaagtggacaagacggccgaaaag
ctgttcggttacggcttaaataccatttgcaaggatgcctgggacaacatgcaccagcag
ctccagcacaaacacaaatatcagaagacgttgaagacggcgttggaaagtcagcacagg
ctggcagcggtgattaagggtctcgacacgaaatcatggaaaataggttttttggccgaa
ttcgaagaattcgttgcagaagaaacggaacatgccgccgcggcggcggcgacgtcttcc
aatcgccagacgtacgaatcggtagccgttgattttttgcgcgacgagcgtcgcttcatt
cgcgaactgaaccgaatcaacgtgtttcgccgacgcatcgaatcgattgccacctcggag
agtgataagacgatagtcgcgaacctattcggcaatctacacgagattcatgacctcgcg
ttgaaaatcgaacgaactttggaagacgcgatcgagttgaacgatacgcaatgcattgga
atgggcatttgggagtatggagaggcgtatgagttcgatacgtacacattctatattaag
agggatgggagtgagatgaatgagtctagacatgctacttatgtgattaatgatactatc
aaggcgcttctggagagtgaacgattctcgaaattgttcatgaaatctggagagcattct
agctccttggatggacagagttttcggctggctgtgcaatatgtgcttcctcaattactt
catattccaattttccatatttatcaatatcatgaatatatcaatagactccaccaacta
agctcttccgaagaagatcgtcgggatctcaacgactgccgtgccgccttcgaacgtgtc
gttggatcagtatccgacatcccaccagagctcaaaacccggatcgcctccttcctagac
caacaagccaagagcgagaagatctacaatgtaaagcgactcaacgagattcaaacttca
atcgatggtttcgtgggaagtcccattggcaaaatgtgcaatgagctggaagcggatgga
gatcttggaatgatccgcccgtctcttcagttgacaagcgacattaccaagaataagaaa
tggaagacagagagatttgtctacgtttttgatcaattgatcatcctttgcaaacgacac
aagaactccctgaaattcaaggatcgcctcccagtgcactccatagacgtcttcgatgtc
cccgattctgaagttttgaactgttttggaatcgaatcgcacgacaagtcatctctcccg
aagacttatcactttgtgtgcagaaatccagaggaaaaacggcaatggatggctgtcctg
gtgaaggtcaccactaaaagtgtcctggaccgtattctggacaattatgaaaaagaggaa
gctaagaggatcccattgattgtcccaggtccagaccagtatcgattctcagagcccgat
acagagagtaacatcacctttgaagactacacgtctagcagcggaatcccg

DBGET integrated database retrieval system