KEGG   Caenorhabditis briggsae: CBG24633Help
Entry
CBG24633          CDS       T01054                                 

Gene name
Cbr-fat-5
Definition
C. briggsae CBR-FAT-5 protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cbr  Caenorhabditis briggsae
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CBG24633 (Cbr-fat-5)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CBG24633 (Cbr-fat-5)
Enzymes [BR:cbr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CBG24633 (Cbr-fat-5)
Lipid biosynthesis proteins [BR:cbr01004]
 Desaturase
  First
   CBG24633 (Cbr-fat-5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
AA seq 333 aa AA seqDB search
MTQIKVDALITNQFLAADLREIRQMQEESKRKPPKTEIVWRNVFLFAALHIGALIGLYQL
VLQAKWATVGWVFLLHTLGSMGVTGGAHRLWAHRSYKARFPMRVFLMLINSIAFQNDIIE
WARDHRCHHKWTDTDADPHSTNRGMFFAHMGWLLVKKHEQLKVQGAKLDLSDLYADRVLM
FQRRNYLPLVGIFCFALPTFIPVYFWGESALIAFYTAALFRYTFTLHATWCINSVSHWIG
WQPYDHQASSVDNLWTSVAAVGEGGHNYHHTFPQDYRTSEHAEFLNWTRVLIDVGATLGL
VYDRKTTAEEVIERQCKKFGCAEERAKMLQKLG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaataaaagtggacgccttaataaccaatcaattcctggcagcggatctccgt
gaaatccgtcaaatgcaagaggagagcaagaggaaaccgccaaaaacggaaattgtttgg
aggaatgtgttcttgtttgcggctcttcatattggagcactgattgggctctatcagttg
gtgttgcaggcaaaatgggcaaccgttggatgggttttcctcctccacacactcggatcc
atgggtgtcactggcggagcccatcgcctctgggctcatcgctcgtacaaagctcgtttc
ccaatgagagtcttcctgatgctcatcaactcgatcgccttccaaaatgacattatcgag
tgggcccgagaccatcggtgtcatcataaatggacggatacggatgctgacccacatagc
acgaatcgaggaatgttctttgctcatatgggatggttgttggtgaagaagcacgagcag
ttgaaggtccagggagccaagttggatttgagtgatttgtatgcggatcgggttctgatg
tttcagagaagaaactaccttcccttggtcggaatcttctgcttcgctcttcccaccttc
atccccgtctacttctggggtgaatctgcactcatcgccttctacaccgccgctctcttc
cgctacaccttcacccttcatgccacatggtgcatcaacagtgtctctcattggatcggc
tggcagccatacgatcatcaagcctcctcagttgacaacctctggacatcagttgctgcg
gttggagaaggcggacacaactaccatcacacgtttcctcaagactaccgtacttcggaa
cacgccgagtttttgaattggacaagagtactgattgatgtcggtgccacgttgggtctg
gtttatgaccgtaagactacagctgaggaggttattgagagacagtgcaagaagtttgga
tgtgccgaggagagagcaaagatgctacagaagctgggctag

DBGET integrated database retrieval system