KEGG   Citrobacter braakii: A6J81_11715Help
Entry
A6J81_11715       CDS       T04825                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
cbra  Citrobacter braakii
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbra00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    A6J81_11715
   00500 Starch and sucrose metabolism
    A6J81_11715
Enzymes [BR:cbra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     A6J81_11715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2388725..2390218)
Genome map
AA seq 497 aa AA seqDB search
MKKIILVVSAALLALSLINMPAWSQPSKETLHNKSISYVNDFFPRVEGSFIGDPMPVYND
GEFDIFYLNDVRGGSDLGVHAIHLLSTTNLYNYQNHSEVIPYVNDVDDPELLLGTGSIVK
VGDTWHAWYTAHNENVFPVESIMHATSKDRLHWVKHPQDTILPGDNYRGNDFRDPHVVWV
EEKKEYWMLITTRRDGRGVIARYSSTDLNNWEDRGVFFDNDTITSNSNLECPTLVFFNGR
WYLSFSDQWPLRLTQYRVADNPDGPWRKMDNYAVDGSGFYAGKLALKNDRLFVFGWIPTK
AGSSDSGNIDWAGNLVVHELIADEQGQLKSILSQELQTVINDNPGPVTTLKSGKMLKTAT
QFGPLQSAVYPPLPKRGELSATIDIPSAGMVMSFGLIDDRVSDAKLNVVFNKSKGKVYFF
NAPLASIHQANAESWVNVPLDEKIELRVLLQDSVAVFYINNKAAFSTRMYSMPEKPWSIS
LPQNDNFHATLKIKEII
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataatattagtggtatctgccgctctgttggcgctttcgcttatcaatatg
ccagcttggtcgcagccgtctaaagaaacattacacaataaaagtattagctatgttaat
gatttttttccgcgggtagaaggttcttttattggtgacccaatgcctgtttataatgat
ggtgaatttgatattttttatcttaatgatgtgcgtggtggtagcgatttgggggtccat
gctattcatttgctatcgactaccaatttatataactatcagaaccattccgaggtgatt
ccttacgttaatgacgttgacgaccctgaactattattaggaaccggttcgattgtgaaa
gttggcgatacctggcatgcctggtataccgcgcacaatgaaaatgtgtttccggttgag
tccattatgcacgcgaccagtaaagaccgtcttcactgggtgaaacatccacaagatacg
atcctgccaggcgataattatcgcgggaatgacttccgggatcctcatgttgtttgggtc
gaagaaaagaaagagtactggatgttaattactacccgtcgcgacgggcgcggtgtcatt
gcccggtacagttcaaccgatttgaataactgggaagaccgtggtgtattttttgataat
gacacgattaccagtaactctaacctcgaatgtccgacactggttttctttaacggacgt
tggtatctcagctttagcgaccaatggccgctacgcctgacccagtaccgggttgcggat
aatcctgatgggccgtggcgaaagatggacaattatgcggtcgatggctcggggttttac
gcgggaaaactggcgcttaaaaacgatcgtctgtttgtttttggttggatcccaactaag
gcaggaagcagtgacagtggcaacattgattgggctggaaatttggttgttcatgagctc
atcgcggatgagcaggggcagctcaaaagcatcctctcgcaggaacttcagacagtcatt
aatgacaaccccggtccggtgaccaccttaaaaagcggtaaaatgctaaaaacagcaaca
cagtttggtccattacaatctgcggtatacccaccgctgcccaaacgaggtgagttaagt
gcaacgatagatatcccctctgccggaatggtgatgagttttggtctgattgacgacagg
gtgagcgacgcaaagctcaacgttgtgttcaataagagcaaaggcaaggtctattttttc
aatgcaccacttgcctctattcatcaggcgaacgcggagtcatgggtaaatgttcctctt
gatgagaaaatagagttacgtgttttgcttcaagactcagttgctgttttttatataaat
aacaaagccgcattcagtacccgaatgtattccatgccggagaaaccatggagtattagc
ctgccgcaaaatgataattttcacgccacattgaaaataaaagaaataatataa

DBGET integrated database retrieval system