KEGG   Coxiella burnetii RSA 331: COXBURSA331_A0008Help
Entry
COXBURSA331_A0008 CDS       T00632                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cbs  Coxiella burnetii RSA 331
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cbs00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(8215..9021)
Genome map
AA seq 268 aa AA seqDB search
MENESLKNKTIMITRPEGQGELLKKAIERRGGAVILFPTLIIKPINKCNYSPFASASFPP
SRESGSPDDKMTKAGFLNSSDILIFLSANAVKHSPILNFKAEQKLVAIGTGTAAALFQRG
LSVDAVPEHFSSEGLLDLPLLHQVTGKTIAIFCGENSRPYLENELIHRGANVFSIITYRQ
ERPVVNKKTIDALTHQTLHAIVSTSAESLQNLCTLFESHQHWLHRIPLVVISKRMENLAK
SQGFHLVLLADNPGEKAIIKVLSTKYPS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgaatccttaaaaaataaaaccatcatgatcactcgccctgaagggcaggga
gaattattaaaaaaagccattgaacgtaggggcggcgccgttattttatttccaaccctt
attataaaaccaattaataaatgcaactactcgcccttcgcatccgcaagttttccacct
tcccgcgaaagcgggagtccggatgataaaatgactaaggctggatttctgaattcaagc
gacatcctcatttttctaagtgcaaatgctgtaaaacattctcctattttaaattttaaa
gcggaacaaaaattagttgctattggcacaggtaccgccgcggctttatttcaacgcgga
ctttctgttgatgccgttcccgaacatttcagtagtgaaggccttttagatttgccttta
ctccatcaggtgactggaaaaacaattgctattttttgcggcgaaaactctcgcccttat
ttagaaaacgaacttatccatcgcggcgcaaatgtattctccattattacttaccgacaa
gaaagacctgtcgtcaataaaaaaacgattgacgcactcactcaccaaacgcttcatgca
attgtctccactagcgccgaaagcctccaaaatctctgcaccttattcgaatcacaccaa
cactggttacaccgtatcccgctcgttgtcattagcaaaagaatggaaaacttagcaaaa
tctcaagggttccacttggtgcttctagcagacaatcctggagaaaaggctattataaag
gttttatccactaaatatccgagttaa

DBGET integrated database retrieval system