KEGG   Coxiella burnetii RSA 331: COXBURSA331_A0008Help
Entry
COXBURSA331_A0008 CDS       T00632                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cbs  Coxiella burnetii RSA 331
Pathway
cbs00860  Porphyrin and chlorophyll metabolism
cbs01100  Metabolic pathways
cbs01110  Biosynthesis of secondary metabolites
cbs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    COXBURSA331_A0008 (hemD)
Enzymes [BR:cbs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     COXBURSA331_A0008 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 DNA_alkylation
Motif
Other DBs
NCBI-ProteinID: ABX78922
Position
complement(8215..9021)
Genome map
AA seq 268 aa AA seqDB search
MENESLKNKTIMITRPEGQGELLKKAIERRGGAVILFPTLIIKPINKCNYSPFASASFPP
SRESGSPDDKMTKAGFLNSSDILIFLSANAVKHSPILNFKAEQKLVAIGTGTAAALFQRG
LSVDAVPEHFSSEGLLDLPLLHQVTGKTIAIFCGENSRPYLENELIHRGANVFSIITYRQ
ERPVVNKKTIDALTHQTLHAIVSTSAESLQNLCTLFESHQHWLHRIPLVVISKRMENLAK
SQGFHLVLLADNPGEKAIIKVLSTKYPS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgaatccttaaaaaataaaaccatcatgatcactcgccctgaagggcaggga
gaattattaaaaaaagccattgaacgtaggggcggcgccgttattttatttccaaccctt
attataaaaccaattaataaatgcaactactcgcccttcgcatccgcaagttttccacct
tcccgcgaaagcgggagtccggatgataaaatgactaaggctggatttctgaattcaagc
gacatcctcatttttctaagtgcaaatgctgtaaaacattctcctattttaaattttaaa
gcggaacaaaaattagttgctattggcacaggtaccgccgcggctttatttcaacgcgga
ctttctgttgatgccgttcccgaacatttcagtagtgaaggccttttagatttgccttta
ctccatcaggtgactggaaaaacaattgctattttttgcggcgaaaactctcgcccttat
ttagaaaacgaacttatccatcgcggcgcaaatgtattctccattattacttaccgacaa
gaaagacctgtcgtcaataaaaaaacgattgacgcactcactcaccaaacgcttcatgca
attgtctccactagcgccgaaagcctccaaaatctctgcaccttattcgaatcacaccaa
cactggttacaccgtatcccgctcgttgtcattagcaaaagaatggaaaacttagcaaaa
tctcaagggttccacttggtgcttctagcagacaatcctggagaaaaggctattataaag
gttttatccactaaatatccgagttaa

DBGET integrated database retrieval system