KEGG   Coxiella burnetii RSA 331: COXBURSA331_A0096Help
Entry
COXBURSA331_A0096 CDS       T00632                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cbs  Coxiella burnetii RSA 331
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cbs00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cbs00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
86223..86708
Genome map
AA seq 161 aa AA seqDB search
MIITLIAAMDKNRLIGRNNELPWHLPADLAHFKSITLGKPIVMGRRTFDSIGKPLPHRRN
IVITQQKNLIIEGCDIFYSLDDALSALTKEPEVIIIGGARIFKEALPKADKMILTIINHS
FEGDVYFPEWNDKEWKITSQIKHERDEKNPYPFQFLELRRL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgattattactctaattgccgcgatggataaaaatcgactgattggccgaaataacgag
ctgccgtggcatttgcctgctgatttagcccattttaaatcgattacgctcggcaagccg
attgtgatgggccgacggacgtttgacagcattgggaaacctttgcctcaccgccgaaat
attgtcattacgcagcaaaaaaatttaattattgaaggttgtgatattttctattctttg
gatgacgcactgagcgcattgaccaaggagcccgaagtaataatcatcggcggcgctcgc
attttcaaagaggcgttgccgaaggccgataaaatgatcttgactatcatcaatcactct
tttgaaggtgatgtttattttcctgaatggaatgataaagaatggaaaattacctcacaa
attaaacacgaacgggacgaaaaaaatccttatccttttcagtttttagaattaaggcga
ttatag

DBGET integrated database retrieval system