KEGG   Coxiella burnetii RSA 331: COXBURSA331_A0391Help
Entry
COXBURSA331_A0391 CDS       T00632                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cbs  Coxiella burnetii RSA 331
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    COXBURSA331_A0391 (folK)
Enzymes [BR:cbs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     COXBURSA331_A0391 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
333624..334184
Genome map
AA seq 186 aa AA seqDB search
MTIAYVGVGANLDNPLKQVQIAVSNLSTLPQTACLGYSSFYRSKPLGPTDQPDYINAVAA
VETTLSPQMLLKALQRLEEKQGRCRGGKRWGPRIIDLDILLYGDLALQSDELCLPHPGLF
VREFVLYPLAEVAEDLILPGGESILELKAKCPDRGIERIIKNPSSLLPFPFRGKGLEKEG
DTKALA
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgacaatagcctatgttggcgtaggggcaaacctggataatccgctcaagcaagtgcaa
atcgcggtaagtaatttgtccacgttgccgcaaactgcttgtcttggctattccagcttt
tatcggagcaaaccgttgggcccgactgatcaaccggattacatcaacgccgtagcagcg
gttgaaactaccttgtccccccaaatgcttttgaaagcattgcaacgacttgaagaaaaa
caaggccggtgtcggggcgggaaacgatgggggccgcggattatcgatctcgatatttta
ttgtatggagatcttgcgcttcagagcgatgagctttgtcttccccatccgggacttttt
gtgcgggaatttgtgctttatccactggctgaagtcgcagaagacttgattttacccggc
ggcgagtctattttggaactgaaagcaaaatgccctgatcgaggcattgaacgaattata
aaaaacccctcttcactacttccttttccctttagggggaaagggttggagaaagagggt
gatacaaaggcgctagcatga

DBGET integrated database retrieval system