KEGG   Coxiella burnetii RSA 331: COXBURSA331_A0399Help
Entry
COXBURSA331_A0399 CDS       T00632                                 

Gene name
algC
Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cbs  Coxiella burnetii RSA 331
Pathway
cbs00010  Glycolysis / Gluconeogenesis
cbs00030  Pentose phosphate pathway
cbs00051  Fructose and mannose metabolism
cbs00052  Galactose metabolism
cbs00230  Purine metabolism
cbs00500  Starch and sucrose metabolism
cbs00520  Amino sugar and nucleotide sugar metabolism
cbs00521  Streptomycin biosynthesis
cbs01100  Metabolic pathways
cbs01110  Biosynthesis of secondary metabolites
cbs01120  Microbial metabolism in diverse environments
cbs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cbs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COXBURSA331_A0399 (algC)
   00030 Pentose phosphate pathway
    COXBURSA331_A0399 (algC)
   00051 Fructose and mannose metabolism
    COXBURSA331_A0399 (algC)
   00052 Galactose metabolism
    COXBURSA331_A0399 (algC)
   00500 Starch and sucrose metabolism
    COXBURSA331_A0399 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    COXBURSA331_A0399 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    COXBURSA331_A0399 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    COXBURSA331_A0399 (algC)
Enzymes [BR:cbs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     COXBURSA331_A0399 (algC)
    5.4.2.8  phosphomannomutase
     COXBURSA331_A0399 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ABX78803
Position
336863..338278
Genome map
AA seq 471 aa AA seqDB search
MAAQGKINQWNVPEIVPATLFRAYDIRGPVTFEALTPGLAYAVGLSIGSEAREQGQKAIV
VGRDGRLSGPKLTAALIQGLCETGLAVLNVGLVPTPLVYFATNRLETNSGVMVTASHNPG
HHNGFKIVLNGKTLRSEEIATIRTRILERRFVKGHGAVVDVDIIEDYESYITKHIQLDRP
LKVVVDCGNGIAGKVAPALYRKLGCEVVELFCEVDGHFPNHHPDPTIPANLTDLIHKVKE
TQADLGLAFDGDADRLGIVTDKGEIIWPDRQMMLFSMDVLSRLPGSDIVFDVKCSRSLAE
IIKKYGGNPVMWRTGHSILKAKLFEIGAPLAGEMSGHIFFKDEWFGFDDGIYVGARLLRI
ISQTNQRTSEIFAELPDSVNTPELKLPMTEEKKQPFMQALLKKADFGNAKLITIDGLRVE
FEDGWGLIRPSNTSPYLILRFEADTEEKLKRIQEIFRTQLRMIDNALELPF
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
ttggcagctcagggcaaaattaatcaatggaatgtccccgagatagtgccggcgacgctt
tttagagcttacgatattcgcggcccggtcacttttgaggcattgacacccggattagct
tatgccgttggcctttcgatcggcagcgaagcgcgcgaacaggggcaaaaagcgattgtc
gtgggtcgcgatgggcgtttatcagggcctaaattaacagctgctttgattcagggattg
tgtgagaccggcctggcggtgcttaatgttggtttggtgccaacgccgctggtttacttt
gccacgaatcgtttagaaaccaattccggcgtgatggtcacagcgagtcataatccgggg
caccacaatggttttaaaattgttctgaatggaaaaacattgaggtcggaagagattgca
accatccgaacgcgtattctcgaaagacgctttgttaaaggccatggcgcggtggttgat
gtggacatcattgaggattatgaatcttatatcaccaagcatattcaattagaccgcccg
ttgaaagtggtcgtggactgtggcaatgggattgccggcaaagtggcgccggcgttatat
cgcaagctagggtgtgaagtagtggagttattttgtgaggtggacggccattttcctaat
catcatcctgaccctactattcccgccaatttaacggatttaatccataaagtaaaagaa
acgcaagccgaccttgggttggcttttgatggcgatgcagatcgtttaggtattgtgacg
gataaaggagaaattatctggcccgatcgtcaaatgatgttattttcaatggacgtatta
tctcgtttaccgggttctgatattgtttttgacgtcaaatgttcgcgttccttagccgaa
ataataaaaaaatacggcggcaatcccgtcatgtggcgaaccgggcattcaattttaaaa
gctaagctttttgaaatcggcgcaccgttggccggagaaatgagcggacatatctttttt
aaagatgaatggtttggttttgatgatggcatttacgtgggagcgcgattattacgaatt
atctcgcagactaatcaacggacgagtgaaatttttgcggagttgcccgatagcgtcaac
acgcccgaattaaaattgccgatgaccgaagaaaaaaaacaaccctttatgcaagcgtta
ttgaaaaaagctgattttggaaacgcgaaacttattacaattgatggattgcgcgttgaa
tttgaagatggttgggggttaattcgaccttccaacacctcgccttatttaattttacgt
ttcgaggctgatacagaagaaaaactaaagcgtattcaggaaatctttcgaacgcagttg
cggatgattgataatgcgttggagttgcccttttaa

DBGET integrated database retrieval system