KEGG   Coxiella burnetii RSA 331: COXBURSA331_A0448Help
Entry
COXBURSA331_A0448 CDS       T00632                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cbs  Coxiella burnetii RSA 331
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:cbs01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cbs01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cbs00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cbs00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cbs00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cbs00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:cbs00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(385691..386689)
Genome map
AA seq 332 aa AA seqDB search
MQLGANVTEIKKLIVLTSGGDAPGMNAAIRAVVRTALHYQFEVYGATAGFAGLVNGQVVP
LNSRAVANCIQRGGTILKTGRFENFRFKAVRDKAREFLKKLQIDAMIVLGGNGSFAGASK
LYQEGGPQMIGIPCTIDNDIQGTDYCIGFDTACNTALQAIDKIRDTAFSHERNFLIEVMG
RSSGFIAVNVGIAGGAEIIALPEFHVDIDTLTQKIKKQHGKKSASIIVAAEANQPGHSFE
VAKQIKEKTGIEYRVCVLGHTQRGGTPTVKDRVLASLMGAQAIEALKKGLTEKMIAYQNG
KIAVAPLPDPDNGTRYFADEALLRVNNIICAM
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcaactaggagccaacgtgaccgaaataaaaaaattaatagtgcttacttctggaggc
gatgcacctggcatgaatgctgcaatccgtgctgttgtgcgaacagcgctccattatcaa
tttgaagtttacggtgccacagccggttttgctggtttagttaacgggcaggtcgttcct
ctcaattcgcgcgcggttgccaattgcatccagcgtggcggtacaattttaaaaacgggg
cgtttcgaaaattttcgtttcaaagcagtccgtgacaaagcgcgggaatttttaaaaaaa
ttgcaaatcgatgccatgatcgttctcggcggcaacggcagttttgcgggcgcttcaaaa
ctgtaccaagaaggcggacctcaaatgattgggattccatgcactatcgataacgacatt
caaggaacggattattgcattggttttgatacggcttgtaatacagctttgcaagctatc
gataaaattcgcgatacggcattcagccacgagcgaaattttttaattgaggttatgggg
cggtcttccggttttatcgcggtgaatgtcggcatcgctggcggtgcggaaatcattgcg
ctacctgaatttcacgtcgatattgatacattgacgcaaaaaattaaaaaacaacacggt
aaaaaatcagcctccattattgtcgctgctgaagccaatcaacccggccacagctttgaa
gtcgccaaacaaataaaagaaaaaaccggcatcgaataccgcgtctgcgtcctcggccac
acccaacgcggcggaaccccaacggtaaaagatcgcgtgcttgcttctctgatgggagca
caggccattgaagcactaaaaaaaggattaaccgaaaagatgatcgcttatcaaaatggt
aaaatagctgttgcgcccctgccggatcccgacaacggaacgcgatattttgctgatgag
gccttgttaagggttaataatattatttgcgccatgtga

DBGET integrated database retrieval system