KEGG   Coxiella burnetii RSA 331: COXBURSA331_A0625Help
Entry
COXBURSA331_A0625 CDS       T00632                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
cbs  Coxiella burnetii RSA 331
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COXBURSA331_A0625
   01230 Biosynthesis of amino acids
    COXBURSA331_A0625
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COXBURSA331_A0625
   00030 Pentose phosphate pathway
    COXBURSA331_A0625
   00051 Fructose and mannose metabolism
    COXBURSA331_A0625
  Energy metabolism
   00680 Methane metabolism
    COXBURSA331_A0625
Enzymes [BR:cbs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     COXBURSA331_A0625
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     COXBURSA331_A0625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
532254..533402
Genome map
AA seq 382 aa AA seqDB search
MEITLSAIKADVGSIGGHTQPSIEMLQAVQQSLQKNIDSGLLIDGLVTFTGDDIAIICSH
QQGLNNEDVHVGFAWQAFLAATEVAKEQGNYGAGQDLLVDAPSGNVRGAGPGVAEIEFTL
NPKSNYRPAESFMIFAGDKCAPGAFNLPLYLVFCDPMHNGGILLNPKIHLGWVFTVIDMD
YKGEDEDRIIQLSVPERSWDVAALLQNPDRYAVESIRSRYKPEEQVVSVSATRLHNIAGK
YTGKDDPIAIIRSQGIFPAPEEIIEPYSTINQIISGDARGSHNMPQLPVPINTPVTGPYC
HPLISALGFSMNKQGKFAGRYVDFFAGSAWDYARYVSQRRAAEIRRQGFMGIAMAQEAEI
AYTGLVDTWKKLDDEFELRKNG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcaccttaagcgctattaaagccgatgtgggcagtatcggcggtcacacccaa
cctagcattgaaatgctacaggctgttcagcaatcccttcaaaagaatatcgactccgga
ttattgatcgatggattggtaactttcactggcgatgatattgcgattatttgttcacat
caacagggtttaaataatgaagacgttcatgtcggttttgcgtggcaagcttttcttgca
gcaactgaagtggcgaaagagcaaggcaattacggcgctggccaggatttactcgtggat
gcgccttctggcaatgttcgaggcgctggacctggtgttgctgaaattgaatttaccctt
aatccaaaatccaattaccgtccggctgaatcctttatgatatttgcaggtgataagtgc
gcacccggcgcatttaatcttcctctttatttagttttttgtgatccgatgcataatggg
ggaattttattaaatccaaaaatacatttaggctgggtgtttacggtgattgatatggat
tacaaaggggaagacgaagatcgtattattcagctttctgttcccgaacgctcctgggac
gttgccgcgttgttgcaaaatcccgatcggtatgcggttgaatccattcgctcacgttat
aaacctgaagaacaagtggtttctgtttctgccacgcgattgcataacattgcaggaaaa
tacacaggcaaggatgatccaattgctattattcgcagtcaaggtatttttccggcacct
gaggaaattattgagccgtattcgactattaatcaaattatcagcggcgatgcgcgcggc
tctcataacatgccgcaattaccggttcctattaatacgcctgttactggaccgtattgt
catcccctaatttcggcacttggtttttccatgaataagcagggtaaatttgctggacgt
tatgtggatttttttgcgggttctgcttgggattacgcgcgttatgtttcccagcgtcga
gcggccgaaattaggcggcaaggatttatgggcatcgctatggcgcaggaagcagaaatt
gcctacactggattagtagatacgtggaaaaaactggatgacgaatttgaattgcgaaaa
aatggataa

DBGET integrated database retrieval system