KEGG   Coxiella burnetii RSA 331: COXBURSA331_A0752Help
Entry
COXBURSA331_A0752 CDS       T00632                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase E2 component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cbs  Coxiella burnetii RSA 331
Pathway
cbs00010  Glycolysis / Gluconeogenesis
cbs00020  Citrate cycle (TCA cycle)
cbs00620  Pyruvate metabolism
cbs01100  Metabolic pathways
cbs01110  Biosynthesis of secondary metabolites
cbs01120  Microbial metabolism in diverse environments
cbs01130  Biosynthesis of antibiotics
cbs01200  Carbon metabolism
Module
cbs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cbs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COXBURSA331_A0752 (pdhC)
   00020 Citrate cycle (TCA cycle)
    COXBURSA331_A0752 (pdhC)
   00620 Pyruvate metabolism
    COXBURSA331_A0752 (pdhC)
Enzymes [BR:cbs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     COXBURSA331_A0752 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ABX78039
Position
complement(667659..668795)
Genome map
AA seq 378 aa AA seqDB search
MKVFKLPDLGEGLPDATIREWYIAVGDEVKIDQPLVAMETAKALVDVPSPLAGKIEKLFG
EVGDVIETGSPLIGFEGEAETEEPKDTGTVVGAIETSDTVLEESGAGIPVKKAAEKKNFK
ATPAVRMLAKQLGVDLTKITPKSSLISAEEVKQAAQITKTGKTQKIEGELTPLSPVRRAM
AQSMSQSHREVVPVSLMDDGDLSAWKGEQDITLRIIRAIEAACQAVPIMNAHFDGETLGY
KLNETINIGIAVDTPQGLYVPVLKDVSHQDDTALRNQINRFKELAQSRSFPPEDLRDATI
MLSNFGAFAGRYANPILLPPMVTIIGVGRTRDEIVPVDGKPAVHRILPLSVTSDHRVITG
GEIARFLKQLIDSLEKAS
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtttttaaattacctgatcttggagagggattgcccgatgccaccattcgagaa
tggtatatcgccgtgggagatgaagtgaagatcgaccagcctttagtggctatggaaaca
gcaaaagcattggtggacgtcccctctcccctggctggcaagatcgaaaagttatttggt
gaagttggcgatgttattgaaacgggaagtcccttgattggatttgaaggcgaagctgaa
accgaagaacctaaagataccggcactgtcgttggagctattgaaacaagcgacactgtt
ttggaggaatcaggcgcgggtatccccgttaaaaaagcggctgagaaaaaaaattttaaa
gccacacccgccgttcgtatgttagccaaacaattgggcgttgatcttaccaagatcaca
cctaaaagctccctaatttctgccgaagaagtcaagcaagccgcccaaattaccaaaacg
ggtaagacccaaaaaattgaaggagaactaacaccgttatctcccgtacgccgggccatg
gcccaaagcatgtctcaatcccatcgagaggtcgttcccgtgagcttaatggatgacggc
gatttatctgcttggaaaggcgaacaagatatcactctgcggattatccgcgcaatcgaa
gcggcttgccaagcagtgcccattatgaacgctcatttcgatggtgaaactctgggttat
aaactgaatgaaacgattaatattggaatagccgtggatactcctcaaggactgtatgtt
cccgtattaaaagatgtcagccatcaggatgacacggcgcttcgcaaccaaattaatcgc
ttcaaagaactcgctcaaagccgcagcttcccgccggaagatctgcgcgacgctacgatc
atgctttctaattttggcgcttttgcgggacgttatgccaatcctattctcttgccacct
atggtgaccattatcggtgttggccgcacccgggatgaaatcgtgcctgttgatggcaaa
cccgctgtccatcggatattgccgctttcagtaacaagcgatcatcgagtaattaccggg
ggcgaaatcgcccggtttttgaagcagctaattgattcgctcgaaaaagcttcctga

DBGET integrated database retrieval system