KEGG   Coxiella burnetii RSA 331: COXBURSA331_A0754Help
Entry
COXBURSA331_A0754 CDS       T00632                                 

Gene name
pdhA
Definition
(GenBank) pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
cbs  Coxiella burnetii RSA 331
Pathway
cbs00010  Glycolysis / Gluconeogenesis
cbs00020  Citrate cycle (TCA cycle)
cbs00620  Pyruvate metabolism
cbs01100  Metabolic pathways
cbs01110  Biosynthesis of secondary metabolites
cbs01120  Microbial metabolism in diverse environments
cbs01130  Biosynthesis of antibiotics
cbs01200  Carbon metabolism
Module
cbs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cbs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COXBURSA331_A0754 (pdhA)
   00020 Citrate cycle (TCA cycle)
    COXBURSA331_A0754 (pdhA)
   00620 Pyruvate metabolism
    COXBURSA331_A0754 (pdhA)
Enzymes [BR:cbs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     COXBURSA331_A0754 (pdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh DXP_synthase_N TPP_enzyme_C Transketolase_N
Motif
Other DBs
NCBI-ProteinID: ABX77381
Position
complement(669980..671086)
Genome map
AA seq 368 aa AA seqDB search
MTPKTTTVANFTIRYLQFLDANSNPTQPFPDFADPDMLLYLYRRMALIRQLDNKAINLQR
TGKMGTYPSSRGQEAVGIGMGSAMQKEDIFCPYYRDQGALFEHGIKLSEILAYWGGDERG
SRYANPDVKDDFPNCVPIAGQLLHAAGVAYAVKYRKQARAVLTICGDGGTSKGDFYEAIN
LAGCWQLPLVFIINNNQWAISVARGEQTHCQTLAQKAIAGGFEGWQVDGNDVIAVRYAVS
KALEKARDGGGPTLIEALSYRLCDHTTADDATRYIPQEEWKVAWQKEPIARLGYYLESQG
LWSREKEAVLQKELAQEVDQVVEEFLTMPPPKATDMFDYLYAELPVSLEKQREELADNKP
SHPSGREG
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaaaaacaacgaccgtcgccaatttcaccatacggtatttacaatttcttgat
gctaacagcaatcctacccaaccctttcccgacttcgccgatcctgacatgctgctttat
ttatatcgtcgaatggcgttgatccgccaattggacaacaaagcgattaatttgcagcga
accggaaagatggggacctatccttcctcccgcggacaggaagcggtgggcatcgggatg
ggaagtgccatgcaaaaggaagatattttttgtccttattatcgggaccaaggagcgcta
tttgaacatgggatcaaattatccgaaattctagcctattgggggggagatgaacggggc
agccggtacgcgaatcccgacgttaaagacgattttccgaactgtgtccctatcgctggg
caacttcttcacgccgcgggagtagcctacgcggtgaaataccgcaaacaagcgcgcgca
gtcctgaccatctgcggggatggcggtacttccaaaggcgatttttacgaggccatcaat
ttagccggttgttggcagttgcctttagtctttattatcaacaacaaccaatgggcgatt
tcagtggctcgcggcgaacaaactcattgccaaacattagctcaaaaagcaatcgccggg
ggatttgaagggtggcaagtggatggaaacgacgtaattgcagtccgctatgccgtctcc
aaagctttagaaaaagcccgcgatgggggaggaccgaccctaattgaagcactctcttat
cggttatgcgatcacaccactgccgatgatgccacccggtatattccacaagaagaatgg
aaagtcgcttggcaaaaagaacctatcgcgaggttggggtattaccttgagtcccaaggc
ctttggtcacgagaaaaagaagccgttttacaaaaagaacttgcccaagaagttgaccag
gtggtagaagaatttttaactatgccaccgcctaaagccacggacatgtttgattatctt
tatgcagaacttccggtatcgttagaaaaacagcgggaggaattggctgataataaaccc
tctcacccttcggggagagaaggttag

DBGET integrated database retrieval system