KEGG   Coxiella burnetii RSA 331: COXBURSA331_A0781Help
Entry
COXBURSA331_A0781 CDS       T00632                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cbs  Coxiella burnetii RSA 331
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cbs01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cbs00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(688764..689888)
Genome map
AA seq 374 aa AA seqDB search
MSETLNLLKQLIERPSITPNDAGCQTILIDRLKSVGFQCEHLPFGEVHNFWAWHGHQSPF
IIFAGHTDVVPPGDETQWHSPPFTPTEKNGYIYGRGAADMKSGLAAMVVAAENFVKQNPD
HNGTIGFIVTSDEEGPAENGTQKVVDYLQQKNIKLDYCIVGEASSNEKLGDAIKIGRRGS
MHGELTIIGKQGHIAYPHLADNPIHRSFQAFEALAKTKWDEGNEHFTPTSFQFYNVEAGA
GAANVIPATLKAKFNFRFAPIHTTQQLQQKVERILNYYQLNYDIQWNVSSQPFFSGNGRL
ATFVRQAIQEICHLNTEPNTYGGTSDGRFIATTGCEVIELGPVNKTAHHVNENICIADLE
KLTDIYFRTLQLLI
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaacgctgaatcttcttaaacaattaatcgagcgcccttccatcacacctaac
gacgcaggttgccaaacaattttaatcgatcgtttaaaatccgtaggctttcaatgcgaa
catttacctttcggcgaagttcataatttttgggcctggcatggccatcaatcacctttt
attatttttgcaggccacacagatgtagttccgcccggcgatgaaacacaatggcactcc
ccccccttcactcccacagaaaaaaatggctatatttatggccgcggcgctgctgatatg
aaaagcggattagccgccatggtcgtcgcggcggaaaatttcgttaaacagaatcccgac
cacaatggcacaatcggatttatcgttaccagtgatgaagaaggcccggccgaaaatggt
acgcaaaaagtcgtggactatttacaacaaaaaaatattaaattggattattgcatcgtg
ggcgaagccagcagcaacgaaaaattgggcgacgccatcaaaattgggcgacgcggttcg
atgcacggggaattaaccatcatcggcaaacaagggcacattgcttatccccatctcgcc
gataatcctattcaccgcagtttccaagccttcgaggcattagcaaaaacaaaatgggat
gaaggcaatgagcattttacccctacttcatttcaattttataacgtcgaagcaggcgcg
ggtgctgccaatgttattcctgcgacgttaaaggcaaaatttaattttcgctttgccccc
attcatacgactcaacaattacaacaaaaagtcgaacgcattttaaattactatcaatta
aactatgacatccaatggaacgtctcaagccaaccgttttttagcggcaacggccggtta
gccacattcgttcgtcaagccattcaagaaatctgccacctcaataccgaacccaatacc
tacggtgggacctcggacggccgctttatcgccaccaccggctgcgaagtcatcgaactt
ggccccgttaataaaacggcccaccacgtcaatgaaaatatttgcatcgcggacttagaa
aaacttacggatatttattttcggactcttcagttgctcatctaa

DBGET integrated database retrieval system