KEGG   Coxiella burnetii RSA 331: COXBURSA331_A0906Help
Entry
COXBURSA331_A0906 CDS       T00632                                 

Definition
isochorismatase family protein (EC:3.-.-.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cbs  Coxiella burnetii RSA 331
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:cbs00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(805404..805673)
Genome map
AA seq 89 aa AA seqDB search
MKTLIIVYVQNDFMPGGSLEVPNANAIIPIINNLQDKFDLIVATQDWHPANHKSFASNHP
GKKPFEKIMLHGLEQTLWPDHCVQGSVGL
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacactcattattgtctatgttcaaaatgattttatgccaggaggctctctagaa
gttcctaacgctaacgcgattattccaattattaataatttacaggataagtttgacttg
attgtggcgactcaagattggcaccctgctaatcacaaaagttttgcctccaatcatccc
ggtaaaaaaccctttgaaaaaattatgcttcacggcctggaacaaactttatggcctgat
cattgcgtccaaggttcggtgggattataa

DBGET integrated database retrieval system