KEGG   Coxiella burnetii RSA 331: COXBURSA331_A0912Help
Entry
COXBURSA331_A0912 CDS       T00632                                 

Definition
phage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
cbs  Coxiella burnetii RSA 331
Brite
Enzymes [BR:cbs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     COXBURSA331_A0912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(808807..809241)
Genome map
AA seq 144 aa AA seqDB search
MTREYAKQALEFLKRHEGFSPHLYKDSVGKWTIGYGRNLEDDPLDEYEAEFLLMQDIERL
DKALSLHEAYQALDNERKAIILDMAYNLGYGGLMKFTHLWQALEKQDYEQAVKEMLNSEW
AEEVKSRATELAQLMDSSWVQNVR
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgactagagaatacgcaaaacaagcgctcgaattcctcaaacgacatgaaggtttttca
cctcatctttacaaagacagcgtcggcaaatggacaatcggctatggtcggaatctcgaa
gacgatccgctggatgaatacgaggctgaatttttacttatgcaagacatcgaacgcctt
gataaggcgctctcacttcacgaagcttatcaagcgcttgataacgaacgaaaagccatc
atcctcgacatggcctataacttaggctatggaggattaatgaaattcacccatctgtgg
caggcactagaaaaacaagactatgaacaagctgtgaaggaaatgcttaatagtgaatgg
gccgaagaagtgaaaagccgagcgactgaattggcccaattgatggattcttcttgggtt
caaaatgtgcgctga

DBGET integrated database retrieval system