KEGG   Coxiella burnetii RSA 331: COXBURSA331_A1011Help
Entry
COXBURSA331_A1011 CDS       T00632                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cbs  Coxiella burnetii RSA 331
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cbs00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(897413..898918)
Genome map
AA seq 501 aa AA seqDB search
MSSFILAIDQGTTSTRAILFNEEAKLVHYHHVEITQYFPQGGWVEHDPEEIWDSTLLCCR
NVLEEASLRAADIAALGISNQRETTILWDRHTGQPLYRAIGWQDRRTVNFCEQLASQAGV
LAKFVEKTGLILDPYFSCSKIKWILDNIKGAYEKAKRGELAFGTVDSYLLWKFTGGKCHA
TDATNASRTGLFNINQQRWDDELLTLFDIPKSLLPTVLDNCAQFGFTDLDLLGHKIPITA
MIGDQQAAAVGQACIKPGMVKSTYGTGCFMLLNTGDQIIHSRNRLLATIAYRLNDTVTYG
LEGSIFIAGAAVKWLRDPLHLIEKANDSESMASSVEDTGGVYLVPAFTGLGAPYWDPNAR
GALFGLTRNTQREHIVRAALEAVCYQSKDLVRAILNDGANLTTLRVDGGMAANNWLLQFL
SDILGVNVDRSRCIESSALGTAFLAGLGAGLFDSLEEMTGLWQADRHFIPQMDPKKQEEL
YDGWQKAVEKTLTPAAPLLFP
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgagtagttttattttagcgattgatcaaggtacaacaagcactcgcgctattcttttt
aacgaagaggccaagcttgttcattatcaccacgttgaaattactcaatatttcccgcaa
ggcggctgggtggagcatgatcccgaagaaatctgggactcgaccctcctttgttgccgt
aacgtacttgaagaagcttctttgcgtgctgccgatattgcagccctaggcatttctaac
caacgcgaaacgactattttgtgggaccgccacactggccagccactttatcgtgctatc
ggctggcaagatcgtcgaaccgtaaacttttgcgagcaattggcttctcaagccggggtt
ctggctaagttcgttgaaaaaacaggattaattctagatccttacttttcttgttctaaa
attaaatggatactagacaatattaaaggtgcttatgaaaaagcaaaacgcggtgagctt
gcttttggcaccgtagattcttatctcttatggaaatttactggcgggaaatgccacgcg
acagatgccactaacgcgtcacgaacggggctatttaatattaaccaacaacgatgggat
gatgaattattaacgctttttgacattcctaaatcgctactccccaccgtacttgataat
tgcgctcaatttggcttcaccgatctcgatcttttaggtcataaaattccaataaccgca
atgattggcgatcagcaagcggctgcggttggccaagcttgtattaaaccaggaatggta
aaaagtacttatgggacgggttgctttatgctgctcaatacaggcgatcaaattattcat
tcaagaaatcgactgttagctaccattgcttaccgtcttaatgacacagtgacttatggg
ctcgaaggcagcattttcattgcaggtgccgcagtaaaatggctgcgagatccgcttcac
ctcattgagaaagcgaacgatagtgaaagtatggcctccagtgttgaggataccggcggg
gtttatttagtgcctgcgttcaccggtttgggagcaccttactgggaccccaacgcgcgg
ggcgctttattcggtctgacgcgcaacacccaacgagagcatattgttcgcgcggctcta
gaagccgtgtgttaccagagcaaagacctcgttcgagcgatattaaatgacggcgcgaat
ttaactacgcttcgcgttgatggcggcatggcggccaataattggttattacaatttttg
tctgatattctgggcgttaatgtggatcgttcgaggtgcattgaaagcagtgcgttaggg
acagcctttctagctggcttaggtgcgggtctttttgactcattagaagagatgacgggt
ttatggcaagccgatcgtcattttatccctcaaatggaccctaaaaaacaggaagaatta
tacgatgggtggcaaaaagccgttgaaaagacccttactcccgcagccccactccttttt
ccataa

DBGET integrated database retrieval system