KEGG   Coxiella burnetii RSA 331: COXBURSA331_A1011Help
Entry
COXBURSA331_A1011 CDS       T00632                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cbs  Coxiella burnetii RSA 331
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbs00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    COXBURSA331_A1011 (glpK)
Enzymes [BR:cbs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     COXBURSA331_A1011 (glpK)
Exosome [BR:cbs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   COXBURSA331_A1011 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(897413..898918)
Genome map
AA seq 501 aa AA seqDB search
MSSFILAIDQGTTSTRAILFNEEAKLVHYHHVEITQYFPQGGWVEHDPEEIWDSTLLCCR
NVLEEASLRAADIAALGISNQRETTILWDRHTGQPLYRAIGWQDRRTVNFCEQLASQAGV
LAKFVEKTGLILDPYFSCSKIKWILDNIKGAYEKAKRGELAFGTVDSYLLWKFTGGKCHA
TDATNASRTGLFNINQQRWDDELLTLFDIPKSLLPTVLDNCAQFGFTDLDLLGHKIPITA
MIGDQQAAAVGQACIKPGMVKSTYGTGCFMLLNTGDQIIHSRNRLLATIAYRLNDTVTYG
LEGSIFIAGAAVKWLRDPLHLIEKANDSESMASSVEDTGGVYLVPAFTGLGAPYWDPNAR
GALFGLTRNTQREHIVRAALEAVCYQSKDLVRAILNDGANLTTLRVDGGMAANNWLLQFL
SDILGVNVDRSRCIESSALGTAFLAGLGAGLFDSLEEMTGLWQADRHFIPQMDPKKQEEL
YDGWQKAVEKTLTPAAPLLFP
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgagtagttttattttagcgattgatcaaggtacaacaagcactcgcgctattcttttt
aacgaagaggccaagcttgttcattatcaccacgttgaaattactcaatatttcccgcaa
ggcggctgggtggagcatgatcccgaagaaatctgggactcgaccctcctttgttgccgt
aacgtacttgaagaagcttctttgcgtgctgccgatattgcagccctaggcatttctaac
caacgcgaaacgactattttgtgggaccgccacactggccagccactttatcgtgctatc
ggctggcaagatcgtcgaaccgtaaacttttgcgagcaattggcttctcaagccggggtt
ctggctaagttcgttgaaaaaacaggattaattctagatccttacttttcttgttctaaa
attaaatggatactagacaatattaaaggtgcttatgaaaaagcaaaacgcggtgagctt
gcttttggcaccgtagattcttatctcttatggaaatttactggcgggaaatgccacgcg
acagatgccactaacgcgtcacgaacggggctatttaatattaaccaacaacgatgggat
gatgaattattaacgctttttgacattcctaaatcgctactccccaccgtacttgataat
tgcgctcaatttggcttcaccgatctcgatcttttaggtcataaaattccaataaccgca
atgattggcgatcagcaagcggctgcggttggccaagcttgtattaaaccaggaatggta
aaaagtacttatgggacgggttgctttatgctgctcaatacaggcgatcaaattattcat
tcaagaaatcgactgttagctaccattgcttaccgtcttaatgacacagtgacttatggg
ctcgaaggcagcattttcattgcaggtgccgcagtaaaatggctgcgagatccgcttcac
ctcattgagaaagcgaacgatagtgaaagtatggcctccagtgttgaggataccggcggg
gtttatttagtgcctgcgttcaccggtttgggagcaccttactgggaccccaacgcgcgg
ggcgctttattcggtctgacgcgcaacacccaacgagagcatattgttcgcgcggctcta
gaagccgtgtgttaccagagcaaagacctcgttcgagcgatattaaatgacggcgcgaat
ttaactacgcttcgcgttgatggcggcatggcggccaataattggttattacaatttttg
tctgatattctgggcgttaatgtggatcgttcgaggtgcattgaaagcagtgcgttaggg
acagcctttctagctggcttaggtgcgggtctttttgactcattagaagagatgacgggt
ttatggcaagccgatcgtcattttatccctcaaatggaccctaaaaaacaggaagaatta
tacgatgggtggcaaaaagccgttgaaaagacccttactcccgcagccccactccttttt
ccataa

DBGET integrated database retrieval system