KEGG   Coxiella burnetii RSA 331: COXBURSA331_A1306Help
Entry
COXBURSA331_A1306 CDS       T00632                                 

Gene name
trpBF
Definition
(GenBank) N-(5'phosphoribosyl)anthranilate isomerase/tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
K01817  phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
cbs  Coxiella burnetii RSA 331
Pathway
cbs00260  Glycine, serine and threonine metabolism
cbs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cbs01100  Metabolic pathways
cbs01110  Biosynthesis of secondary metabolites
cbs01130  Biosynthesis of antibiotics
cbs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbs00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    COXBURSA331_A1306 (trpBF)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    COXBURSA331_A1306 (trpBF)
Enzymes [BR:cbs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     COXBURSA331_A1306 (trpBF)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     COXBURSA331_A1306 (trpBF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PRAI
Motif
Other DBs
NCBI-ProteinID: ABX77464
Position
1182976..1184709
Genome map
AA seq 577 aa AA seqDB search
MGADFIGIITYSKSKRYVNNKMAQNLSKAIRKAGGRPVAVFVDFSAKAMESFCKSTGIDV
VQLHGAISKAEHHLLPASLQRIYVLSVNKNGSILKDDAGGLEHLDEKRDFLLFDNEIGGS
GQSYDLNQFNYTGKFRYFLSGGLSPTNVNRAIQLTKPQGVDVSSGVEDSNGNKKLTLIQS
FITNVRKNPAGRFGTFGGCYVAETLMAPLQELQESMTRIVKSNVFQTTFHDILQHYAGRP
TPLTEAKRLSDFIQGPRIFLKREDLLHTGAHKINNSLGQCLLAKKLKKTRIIAETGAGQH
GVASATACAYFDLRCDIYMGAEDMKRQAPNVERMKLLGANVIPVLAGSQTLKDAVNEALR
DWSASYENTHYCLGSALGPHPFPEMVALFQSVIGKEAKTQVHEQTGKQPDAIIACVGGGS
NAIGIFSAFIDDPTVRLIGVEAGGKGNQLGEHAAWIKHQRKGVLHGTYTYLLQDENGQIA
KTHSISAGLDYPAIGPQHAFLFETGRAIYTNVSDKDALTAFKLLAKTEGIIPALESSHAI
AYLLKEGRKKFSRKDIVIVNLSGRGDKDIPALKEYSL
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgggagcggattttattggtatcattacctattcaaaatcaaaacgttatgtaaataat
aaaatggctcaaaatctttcaaaagctattaggaaagcaggcggcagacccgttgctgtt
ttcgttgatttttcagcaaaagccatggaatctttttgtaagtccacgggaatcgatgtc
gtgcagttacatggcgctatttcaaaagccgaacatcatctattgccagcatcattgcaa
cgcatttatgttctctccgttaataaaaacgggtcgattttaaaagacgacgccggaggg
cttgagcatctagatgaaaaaagggattttcttttatttgataatgaaattggcggaagt
ggccaatcctacgacctgaatcaatttaattatactggaaaattccgttactttttatcg
ggcggtctgtctcctacgaatgtaaatcgcgcaattcaattaacaaaaccacagggcgta
gacgtttccagtggtgttgaagatagtaacggcaataagaagttaacgcttatccaatct
tttattaccaatgtccgaaaaaatccggcagggcgctttggcacttttggcggttgctat
gtcgctgaaactttaatggctcccctacaagaattacaagaatccatgacgcgcattgta
aaatcaaacgtctttcaaaccacttttcacgatattttacaacattacgcgggtcgtcca
acgccattaacggaagcaaaacgattgagtgattttattcaaggtccgcgtattttttta
aagcgcgaagatttattacataccggcgcacacaaaataaataattccttgggacaatgt
ttgctggctaaaaaactgaaaaagactcgcatcatcgctgaaaccggcgcgggacagcac
ggggtggcgagtgcaactgcctgtgcttattttgatttgcgttgcgatatttatatgggc
gccgaggatatgaaacgccaagcgcctaatgtagagcgaatgaagttattaggcgccaac
gtgattcccgttttagctggatcacaaacattaaaagacgctgtcaacgaagcattacgt
gattggtccgccagttatgaaaatacccactattgtttagggtcagcgctaggtccgcat
ccttttcctgaaatggtggctctttttcagtctgttattggtaaagaagccaaaactcaa
gtccatgaacaaacgggaaaacaacctgatgctattatcgcctgcgttggtggcggttca
aatgcgattggtattttttcagcgtttattgacgatccaaccgtaaggttaattggcgtt
gaagcgggtggtaaaggcaaccaactgggcgagcatgccgcgtggattaaacaccaacgc
aaaggcgttctgcatggcacttatacttatcttttacaagatgagaatggccaaattgcg
aagacgcactctatttcggctggcttggattacccagcgatcgggccacaacatgctttc
ctttttgaaacgggtcgagccatttataccaacgtcagcgataaagacgcattaaccgca
tttaaattattagcaaaaacggaaggcattattccagcgctggagtcatctcacgcgata
gcttatttattaaaggaaggaaggaaaaaattttcgcgaaaagacattgtcatcgtcaat
ttatcagggcgcggcgacaaagatattcctgcactcaaggagtatagtttataa

DBGET integrated database retrieval system