KEGG   Coxiella burnetii RSA 331: COXBURSA331_A1308Help
Entry
COXBURSA331_A1308 CDS       T00632                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cbs  Coxiella burnetii RSA 331
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    COXBURSA331_A1308 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    COXBURSA331_A1308 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    COXBURSA331_A1308 (trpA)
Enzymes [BR:cbs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     COXBURSA331_A1308 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1184726..1185529
Genome map
AA seq 267 aa AA seqDB search
MNRIEQQFKKSPAYVAYLTAGDGGLERSLESLLALAKGGVNILEVGVPFSDPVADGPVIQ
EASIRALAQGTTLHDVLTLITSFRQHSEIPIILFTYFNPLLAAGDKIYQQMKSAGVDGCL
VVDLPVEEAAPHLTACKTAKIAPILLISPSTTQERLKKINEHGEGMLYYVCRPGTTGVRA
TLPENFPAKMNQIKSMTSLPIVTGFGIANRKMAAQALQYADGFVIGSLFVKAIAEGISKN
ALTRLAQSLNPHYPNLRLITPFRKKTF
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcattgaacaacaatttaaaaagtctcctgcttatgtcgcttatttaacggcc
ggcgacggtggactggagcgttcgttagaaagtctattggctttagcaaaaggcggcgtt
aatattttagaagttggcgtcccgttttctgaccctgttgctgacgggccggtgattcaa
gaagccagcatccgtgcgctggctcaaggcactactttacacgacgtattaacgttaata
acgtcgtttagacaacacagtgaaattcccattattttatttacttattttaatcccctc
ttagcagccggcgataaaatttatcaacagatgaaatcggctggtgtggacggttgttta
gtcgttgatttacctgtagaagaagcagccccgcacctcactgcttgcaaaaccgcaaaa
attgctccaattttattaatctcaccctccacgacgcaagagcgtttaaaaaaaattaat
gagcacggagaaggaatgttgtattacgtatgccggcctggaacaaccggcgttcgagcc
accctgcctgaaaattttcccgctaaaatgaatcaaataaaatcaatgacgagcctaccc
atcgttaccggtttcggcatcgctaatcgaaaaatggccgcccaagcgttgcagtacgct
gacggttttgtaatcggttcgttatttgtaaaagcaatcgcagaaggaatcagcaaaaac
gcattaactcgtcttgcacaatcgctcaacccgcattaccccaacctacggctcatcacc
ccttttagaaaaaagaccttttag

DBGET integrated database retrieval system