KEGG   Coxiella burnetii RSA 331: COXBURSA331_A1309Help
Entry
COXBURSA331_A1309 CDS       T00632                                 

Definition
putative 7-dehydrocholesterol reductase
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
cbs  Coxiella burnetii RSA 331
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbs00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    COXBURSA331_A1309
Enzymes [BR:cbs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     COXBURSA331_A1309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1186352..1187719
Genome map
AA seq 455 aa AA seqDB search
MTPEVQHNASYRLLRYSLFPLFLITVCPPAAIIMWYTNVALNGSLTALAVLFTQKGFFTT
LYQIWSPVFFGTREAWFIISIFMITQLLLMRIVPGKRFEGPITPKGNVPVYKANGVLCFG
ITLTLFYLCAYQFRWFPPTIVYDHFGGILGALNIFSLIFCFILYFKGRFAPSTSDHSLSG
NFIFDYYWGTELYPRILGWDIKMFTNCRFGMMGWPIIILSFAAKQNQLYGLSNSMLVALL
IQLVYIGKFFWWERGYLRSLDIMHDRAGFYICWGCLVWVPSIYTSPLLYLVNHPIPLSWF
SADIILFLGVGCVFINYFADAQRQKVRASNGNCKIWGKKPALIRATYTTEQGKQKQTVLL
ASGWWGISRHFHYLPEIGAAFFWTVPALFSHFLPYFYVVYLTILLTHRSLRDENRCHKKY
GPDWEIYCQQVPSRIIPYFLTKRFNAMVKWRKSAN
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgacaccggaagtgcagcacaacgcgtcttatcgattattgcgttattctttgtttcca
cttttcttaattaccgtctgcccgcctgccgctattattatgtggtacacgaacgtcgct
ttgaatggttccttaacagcgctagctgttcttttcacgcagaaaggattttttaccact
ctttatcagatctggagtcctgtcttttttggcacgcgagaagcttggttcattattagt
atctttatgatcactcaattgttactcatgcgaatagtccctgggaaacgtttcgagggt
cctatcacaccaaaagggaacgttcctgtctacaaagcgaatggggttttatgctttggt
attacgttgacgttattttacctttgtgcttatcaatttcgatggtttccgccgactatt
gtttacgatcattttggcggtattttaggtgcgttaaatatttttagtttaattttttgt
ttcattctttatttcaaagggcgttttgcaccctccacttccgatcatagtctaagcggt
aattttatttttgactattattggggaaccgaactatatccccgcattcttggatgggat
atcaaaatgttcaccaactgccgtttcggaatgatggggtggccgattattatcttgtca
tttgctgcaaaacaaaatcaattgtatggattaagcaattcgatgttagttgcgctattg
attcagttagtttatatcgggaaatttttttggtgggagagaggttatttgcgttcattg
gatatcatgcacgatcgagccggtttttatatctgttggggatgtttagtgtgggtcccg
agcatttatacttctcctctcttatatttagttaatcatcccattcccttaagctggttc
agtgcagatataattttatttttgggggtcgggtgtgttttcattaattattttgccgat
gcgcagcgccaaaaagttagagcctctaacggtaattgtaaaatttggggcaaaaagcct
gccctcattcgggccacttacacaacggagcaaggtaagcaaaagcaaacggtgttactg
gcttcgggctggtggggaatttctcggcattttcattacctcccggaaataggcgctgct
tttttctggacagtacctgcattattttcacattttttgccatatttttatgtagtttat
ttaactattttacttacgcatcgttcgctacgcgatgagaatcgttgccataaaaaatac
ggccccgattgggaaatttactgccaacaggtaccctctcggataattccttatttttta
actaaaagattcaatgctatggtaaaatggcgaaaatctgcaaattaa

DBGET integrated database retrieval system