KEGG   Coxiella burnetii RSA 331: COXBURSA331_A1422Help
Entry
COXBURSA331_A1422 CDS       T00632                                 

Definition
(GenBank) putative 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cbs  Coxiella burnetii RSA 331
Pathway
cbs00010  Glycolysis / Gluconeogenesis
cbs00030  Pentose phosphate pathway
cbs00051  Fructose and mannose metabolism
cbs00052  Galactose metabolism
cbs00680  Methane metabolism
cbs01100  Metabolic pathways
cbs01110  Biosynthesis of secondary metabolites
cbs01120  Microbial metabolism in diverse environments
cbs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cbs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COXBURSA331_A1422
   00030 Pentose phosphate pathway
    COXBURSA331_A1422
   00051 Fructose and mannose metabolism
    COXBURSA331_A1422
   00052 Galactose metabolism
    COXBURSA331_A1422
  Energy metabolism
   00680 Methane metabolism
    COXBURSA331_A1422
Enzymes [BR:cbs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     COXBURSA331_A1422
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     COXBURSA331_A1422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Sirohm_synth_M
Motif
Other DBs
NCBI-ProteinID: ABX78337
Position
1299343..1300605
Genome map
AA seq 420 aa AA seqDB search
MSKKNVFYAQSGGATAVINATACGVIQTAAQYPTKLGKVLAGRNGIIGALKEELIDTSLE
SLENIAALRHTPSSAFGSCRYKLNNIHHDRRQYERLIEVFKAHDIGYVFYNGGGDSQDTT
HKISQLSQLMDYPLVCIGLPKTIDNDLPFTDNCPGFGSVAKYIAVSTQEAALDVRGMCAT
STKIFILEVMGRHAGWIAASSALGKSQPDDAPHLILFPEVPFQTEQFLTKVSRSVEKNGY
CVIVASEGIRHPDGRFVAESGLHDAFGHEQLGGVAPILARLIKKRLNFKYHWAVADYLQR
AARHIASQTDLDQAYALGKTAVEFALAGKSDVMLTIQREMGSDYKWRIGTAPLCEVANVE
HKMPSHYISEDGFGITEACYTYLKPLIEGESYPPYKNGVPDYVTLKNQLVAKKLKEAFAV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaaaacgtcttctacgcccaatcgggcggtgccacggcggtgattaatgcg
acagcctgcggagtcatacaaacagccgctcaatatcccactaaacttggaaaagttctg
gcgggacgtaacgggattattggtgctcttaaagaggagctcattgataccagtctggag
tctcttgaaaatatcgctgctttgcggcacaccccttcgagcgcttttgggtcctgccgc
tataaactgaacaatatccatcacgatcgccgtcaatatgagcggcttatcgaagttttt
aaagcgcatgatatcggctacgtgttttacaacggcggtggcgattcccaagacaccacg
cataaaatttcgcagttaagccaactaatggattatcccctggtttgcattggtctaccc
aaaaccatcgataacgatctcccttttactgataattgtccgggctttggttctgttgct
aaatatattgctgtttccactcaagaagcggctttggatgtacgcggtatgtgtgcgacc
tcgaccaagatttttattctggaggtcatggggcgccatgcgggctggattgcggcgtcg
tctgcattgggaaaatcccaacctgacgacgcgccacacttgattctatttcccgaagtt
cccttccaaaccgaacaattcctaacaaaagtaagcagatccgttgaaaaaaatgggtat
tgtgtcattgtggcttctgaaggtatccgtcatcccgacggacgatttgtagcggaatcc
ggattgcacgacgcttttggccatgaacaattaggcggggtggcacctattttagcaagg
ctgatcaaaaaacgacttaattttaaataccattgggccgttgcggattatttacaacga
gcggcccgccacattgcctctcaaacggatcttgatcaagcgtacgctctaggaaaaacc
gccgtggaattcgcgcttgctggaaaatccgatgtgatgctcaccatccaacgcgaaatg
ggttctgattataagtggcgcatcggcacggctcccttgtgcgaagtcgctaatgtggag
cacaaaatgccaagccattatatcagcgaagacggatttggcatcacagaagcttgctat
acgtatcttaaacctctgattgaaggggaaagctaccccccttataaaaatggggtaccc
gattacgtcaccctaaaaaaccagttggttgcaaagaaattgaaggaagcttttgctgtt
tag

DBGET integrated database retrieval system