KEGG   Coxiella burnetii RSA 331: COXBURSA331_A1558Help
Entry
COXBURSA331_A1558 CDS       T00632                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cbs  Coxiella burnetii RSA 331
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cbs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COXBURSA331_A1558 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    COXBURSA331_A1558 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    COXBURSA331_A1558 (sucB)
Enzymes [BR:cbs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     COXBURSA331_A1558 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1427716..1428924)
Genome map
AA seq 402 aa AA seqDB search
MAIEIKVPTLPESVSDATVAKWYKKEGDSISRDENLVDLETDKVMLEVPAPKDGVVEKIV
AKEGEVVKADQILALLKEGGAVAKEKEKKDEKETKKEKEKKEEKKDKEKTEEKESDLSPA
VRRMVSEKDVDVEEIEGSGKGGRITKKDVEDYLEKQKEKPSEGKEGPADERTEKRVPLSR
IRQRVAERLVQVQQEAALLTTFNEINMQLVMELRKKYREEFEKKFKVRLGFMSFFTKAVV
EALKRFPMVNASIDGSDIIYHNYYDIGIAIGTERGLIVPILRNAEKMNMADIEKQIREYA
SRAQEGRLNIEELTGGTFTITNGGTYGSLLSTPIINPPQTAILGMHKIMDRPTVENGEVV
VRPIMQVALSYDHRVIDGREAVLFLVTIKELLEDPARMILEC
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctatagaaattaaagtacctacgttgcctgaatcggttagcgatgccacggttgca
aagtggtataaaaaagaaggcgattccatttcacgggatgaaaatctagtcgatttggaa
acggataaagtcatgttggaggttcccgccccgaaagacggtgtggttgaaaaaatcgtc
gcgaaagaaggcgaagtcgttaaagccgatcaaatccttgcccttttaaaagaaggcggc
gctgtggccaaagaaaaagaaaagaaagacgaaaaagaaacgaaaaaagaaaaagagaaa
aaagaagaaaagaaagataaggaaaaaactgaagaaaaagaatctgatctcagtcccgcc
gtgcgacgtatggtttcggaaaaagacgttgatgtcgaggaaattgaaggaagtggaaaa
ggagggcggattacgaaaaaagacgtggaagattatttagaaaaacaaaaagagaaaccc
tccgaaggaaaagaagggcctgccgatgaacgcacggaaaaacgcgtgcctttatcccgc
atccggcaacgtgttgcggagcggttagtgcaagtccaacaagaagcggctttattaacg
acgtttaatgaaattaacatgcagctggtaatggagttgcgaaaaaaataccgcgaagag
ttcgaaaagaaattcaaagttcgattgggttttatgtccttttttaccaaagccgtcgtt
gaagcgttaaaacgttttcccatggtaaacgcctcgatcgatggtagtgatattatttat
cacaattattacgacatcggtattgctattggcactgaacgcggattaattgtccctatt
cttagaaacgccgaaaaaatgaatatggccgatattgaaaaacaaattcgtgaatacgct
tctcgagctcaagaaggtcgtttgaatattgaggaactaacgggaggcacttttacaatt
acgaatggcggaacttacggctcgcttctctcaacgcctataattaatccgccccaaacc
gctattttggggatgcataaaataatggaccgtccaacggttgaaaacggagaagtcgtg
gttcgtccgatcatgcaagtggcattatcttacgatcatcgggtgattgacgggcgagaa
gccgtgttatttttagtgaccattaaagagcttttggaagatccagctcgaatgattttg
gagtgttaa

DBGET integrated database retrieval system