KEGG   Coxiella burnetii RSA 331: COXBURSA331_A1562Help
Entry
COXBURSA331_A1562 CDS       T00632                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
cbs  Coxiella burnetii RSA 331
Pathway
cbs00020  Citrate cycle (TCA cycle)
cbs00190  Oxidative phosphorylation
cbs00650  Butanoate metabolism
cbs01100  Metabolic pathways
cbs01110  Biosynthesis of secondary metabolites
cbs01120  Microbial metabolism in diverse environments
cbs01130  Biosynthesis of antibiotics
cbs01200  Carbon metabolism
Module
cbs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cbs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cbs_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cbs00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    COXBURSA331_A1562 (sdhD)
   00650 Butanoate metabolism
    COXBURSA331_A1562 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    COXBURSA331_A1562 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DUF1211 CybS Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: ABX77220
Position
complement(1434276..1434617)
Genome map
AA seq 113 aa AA seqDB search
MVDRTSRRGYRDWFVQRITALLSGIYAVFVIVFLLVHHPISYPQWHALFSHLIMKIFTLI
VIFSILWHAWIGMWTIFTDYVKNKPIRLALETLVCLLLVGYFVWAIEFLWIAR
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggtagataggaccagccgtcgcggctatcgtgactggttcgttcagcggattaccgcc
ttattaagcggtatttatgcggtttttgtcattgtttttttgctcgtccaccatcccatt
tcttaccctcagtggcacgcattatttagtcatttaataatgaaaatattcaccctcatc
gttattttcagcattttatggcacgcctggattggcatgtggacaatctttaccgattat
gtaaaaaacaaacccatacggctcgctttagagactctggtttgtttattgttagtgggc
tatttcgtatgggccatcgaatttttgtggatagcgcgttga

DBGET integrated database retrieval system