KEGG   Coxiella burnetii RSA 331: COXBURSA331_A1584Help
Entry
COXBURSA331_A1584 CDS       T00632                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cbs  Coxiella burnetii RSA 331
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    COXBURSA331_A1584 (hemB)
Enzymes [BR:cbs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     COXBURSA331_A1584 (hemB)
Exosome [BR:cbs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   COXBURSA331_A1584 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1449774..1450778)
Genome map
AA seq 334 aa AA seqDB search
MAIDALPRVRLRRLRQHPGLRELISEHRLSVKDMILPLFVRAGQKIKNPIASMPGHFQWS
VDQLDEEVERIEASQLPGIILFGIPDFKDATGSSALQPDGVVQQAIQRIKKKAPRLLIVA
DLCFCEYTDHGHCGVVSKNIRGNNDVDNDNTLKLLVAQAISLVRAGADVIAPSGMMDGMV
QAIRRGLDHVGFTEIPILSYAVKYASSFYGPFREAAEGTPQFGDRKTYQMNPANAGIALR
EAELDVAEGADFLMVKPAQAYLDIIYRIKQHFPRIPLGAYQVSGEFAMIKAAAARGWLDE
TQAMMESLLSIKRAGADFIITYFAKEAAGFLGRE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggctattgatgcgctgcctcgagttcgactgcgtcgtttgcgccagcaccccggactt
cgcgaattaattagtgaacatcgtttgtccgtaaaagatatgattctgcctttgttcgtg
cgagcggggcagaaaatcaaaaacccgatagcctcgatgcccgggcactttcagtggagc
gttgatcagctcgatgaagaagttgaacgaattgaggcttctcaattaccggggatcatc
ttgtttggcatccccgactttaaagatgcaacaggttcctcagccttgcagcccgatggc
gttgttcagcaggcgattcagcgaattaagaagaaagcaccgcggctcttaattgttgcg
gatttgtgtttttgcgaatataccgatcacggccactgtggcgttgtgtcgaaaaacatt
cgcggcaataacgatgttgataacgacaatacccttaaattattagtggctcaagccatc
agcttagttcgtgctggcgctgatgtgattgcgccaagtggtatgatggacggcatggtt
caggcaatccgtcgggggctggatcacgtaggattcacagaaattcctattctcagttat
gcggttaaatacgcatccagtttttacggcccttttcgcgaagccgctgaaggaacgccg
caatttggcgatcgtaaaacttatcagatgaatccggcgaatgccggtattgccttacgc
gaagccgaattggacgtcgccgaaggcgcggatttcttaatggttaaaccggcgcaagcg
tatttagatattatttatcgtattaaacaacatttccctcgcattccactcggtgcttac
caggtcagcggcgaatttgccatgatcaaagccgccgccgcccgcggttggctcgatgaa
acacaagcaatgatggaaagtttattgtctatcaaacgcgccggagcggattttattatt
acctattttgctaaagaagcggctgggtttttaggaagagaataa

DBGET integrated database retrieval system