KEGG   Coxiella burnetii RSA 331: COXBURSA331_A1621Help
Entry
COXBURSA331_A1621 CDS       T00632                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cbs  Coxiella burnetii RSA 331
Pathway
cbs00010  Glycolysis / Gluconeogenesis
cbs00051  Fructose and mannose metabolism
cbs00562  Inositol phosphate metabolism
cbs01100  Metabolic pathways
cbs01110  Biosynthesis of secondary metabolites
cbs01120  Microbial metabolism in diverse environments
cbs01130  Biosynthesis of antibiotics
cbs01200  Carbon metabolism
cbs01230  Biosynthesis of amino acids
Module
cbs_M00002  Glycolysis, core module involving three-carbon compounds
cbs_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cbs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COXBURSA331_A1621 (tpiA)
   00051 Fructose and mannose metabolism
    COXBURSA331_A1621 (tpiA)
   00562 Inositol phosphate metabolism
    COXBURSA331_A1621 (tpiA)
Enzymes [BR:cbs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     COXBURSA331_A1621 (tpiA)
Exosome [BR:cbs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   COXBURSA331_A1621 (tpiA)
  Exosomal proteins of bladder cancer cells
   COXBURSA331_A1621 (tpiA)
  Exosomal proteins of melanoma cells
   COXBURSA331_A1621 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABX79042
UniProt: A9N8X5
Position
complement(1482675..1483442)
Genome map
AA seq 255 aa AA seqDB search
MQRRPLVAGNWKMHGSRESVGQLLRALKHGCERLETAELAVFPPFVFLQQCEEALMRTQI
SWGAQDVSEFERGAYTGEVSAAMLRDFHCRYVIVGHSERRQRHGETNEQVAAKVRAALRC
GIRPIICVGETEKQRNANQTLSVIKEQLAVVLQMNDNLASLEGMVVAYEPIWAIGTGKNA
TPSQAEEVHAALRDQLHRQDATLAESTRLLYGGSVKPDNAAALFEMPNIDGALVGGASLE
AEQFLKIGQQCNQSF
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtcgaccgttagtggctggtaattggaaaatgcatggttcgcgcgaaagtgtg
ggtcaattattaagggcattaaaacacggttgcgagcgtctggaaacggcggagctcgct
gttttccccccttttgtctttttgcagcaatgcgaagaggcgctgatgcgaacgcaaatc
tcttggggtgcgcaggacgtttccgaattcgaaagaggcgcttatacgggggaagtctct
gctgccatgctgcgcgatttccattgccggtatgtaatcgtcggccactcggaaaggcgt
cagcgtcacggagaaaccaatgagcaagtggctgcgaaggttagggcagccctccgttgc
ggcattcgtcctattatttgtgtaggggaaactgaaaagcagcgcaatgctaatcagaca
ttatcagtgataaaagagcaacttgcagttgtattgcagatgaacgataatttggcgtcg
ttggaaggcatggtggtggcttatgagccgatatgggcgattggaaccggaaaaaatgca
acgccttcgcaagcagaagaagtgcacgcagcccttcgagatcaattacaccgtcaggat
gcgacactagccgaaagcacgcggcttttatatgggggcagtgttaagccggataatgca
gccgctttgtttgaaatgccaaatatagatggcgctttagtgggtggggcttctttggaa
gctgaacaatttctaaaaatagggcaacaatgcaatcaatcattttaa

DBGET integrated database retrieval system