KEGG   Coxiella burnetii RSA 331: COXBURSA331_A1621Help
Entry
COXBURSA331_A1621 CDS       T00632                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cbs  Coxiella burnetii RSA 331
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cbs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COXBURSA331_A1621 (tpiA)
   01230 Biosynthesis of amino acids
    COXBURSA331_A1621 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COXBURSA331_A1621 (tpiA)
   00051 Fructose and mannose metabolism
    COXBURSA331_A1621 (tpiA)
   00562 Inositol phosphate metabolism
    COXBURSA331_A1621 (tpiA)
Enzymes [BR:cbs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     COXBURSA331_A1621 (tpiA)
Exosome [BR:cbs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   COXBURSA331_A1621 (tpiA)
  Exosomal proteins of bladder cancer cells
   COXBURSA331_A1621 (tpiA)
  Exosomal proteins of melanoma cells
   COXBURSA331_A1621 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1482675..1483442)
Genome map
AA seq 255 aa AA seqDB search
MQRRPLVAGNWKMHGSRESVGQLLRALKHGCERLETAELAVFPPFVFLQQCEEALMRTQI
SWGAQDVSEFERGAYTGEVSAAMLRDFHCRYVIVGHSERRQRHGETNEQVAAKVRAALRC
GIRPIICVGETEKQRNANQTLSVIKEQLAVVLQMNDNLASLEGMVVAYEPIWAIGTGKNA
TPSQAEEVHAALRDQLHRQDATLAESTRLLYGGSVKPDNAAALFEMPNIDGALVGGASLE
AEQFLKIGQQCNQSF
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtcgaccgttagtggctggtaattggaaaatgcatggttcgcgcgaaagtgtg
ggtcaattattaagggcattaaaacacggttgcgagcgtctggaaacggcggagctcgct
gttttccccccttttgtctttttgcagcaatgcgaagaggcgctgatgcgaacgcaaatc
tcttggggtgcgcaggacgtttccgaattcgaaagaggcgcttatacgggggaagtctct
gctgccatgctgcgcgatttccattgccggtatgtaatcgtcggccactcggaaaggcgt
cagcgtcacggagaaaccaatgagcaagtggctgcgaaggttagggcagccctccgttgc
ggcattcgtcctattatttgtgtaggggaaactgaaaagcagcgcaatgctaatcagaca
ttatcagtgataaaagagcaacttgcagttgtattgcagatgaacgataatttggcgtcg
ttggaaggcatggtggtggcttatgagccgatatgggcgattggaaccggaaaaaatgca
acgccttcgcaagcagaagaagtgcacgcagcccttcgagatcaattacaccgtcaggat
gcgacactagccgaaagcacgcggcttttatatgggggcagtgttaagccggataatgca
gccgctttgtttgaaatgccaaatatagatggcgctttagtgggtggggcttctttggaa
gctgaacaatttctaaaaatagggcaacaatgcaatcaatcattttaa

DBGET integrated database retrieval system