KEGG   Clostridium botulinum E3: CLH_0254Help
Entry
CLH_0254          CDS       T00767                                 

Gene name
rpsE
Definition
30S ribosomal protein S5
Orthology
K02988  
small subunit ribosomal protein S5
Organism
cbt  Clostridium botulinum E3
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:cbt00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    CLH_0254 (rpsE)
Ribosome [BR:cbt03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    CLH_0254 (rpsE)
  Bacteria
    CLH_0254 (rpsE)
  Archaea
    CLH_0254 (rpsE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
259446..259943
Genome map
AA seq 165 aa AA seqDB search
MRIDPSTLDLKEKVVDINRVTKVVKGGRNFRFSALVVVGDENGHVGVGMGKSIEIPEAIK
KGIEDAKKNLVEVAMLGTTVPHQINGKFGTGNVLIMPAKQGTGVIAGGPARSVLELAGLK
DVRAKSLGSNNPKNMVKATINGLASLRTAEDIAKLRGKSVEEILG
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcgatcctagtacactagaccttaaagaaaaggttgttgatataaacagagtt
actaaggttgttaaaggtggtagaaacttcagattcagcgctctagttgttgttggagac
gaaaacggacacgttggcgttggaatgggtaaatctatcgaaattcctgaagcaatcaaa
aaaggaatagaagatgctaagaaaaacttagtagaagttgcaatgttaggaactactgtt
cctcatcaaatcaacggaaaatttggaacaggtaatgttctaataatgccagctaaacaa
ggtacaggagttattgctggaggtccagcaagatctgtattagaattagcaggtttaaaa
gatgtaagagctaaatcattaggttcaaacaaccctaaaaacatggttaaagctacaata
aacggattagcaagcttaagaacagctgaagatatagctaaattaagaggaaaatctgta
gaagaaatattaggttag

DBGET integrated database retrieval system