KEGG   Clostridium botulinum E3: CLH_0735Help
Entry
CLH_0735          CDS       T00767                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cbt  Clostridium botulinum E3
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cbt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLH_0735
   01230 Biosynthesis of amino acids
    CLH_0735
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLH_0735
   00030 Pentose phosphate pathway
    CLH_0735
   00051 Fructose and mannose metabolism
    CLH_0735
   00052 Galactose metabolism
    CLH_0735
  Energy metabolism
   00680 Methane metabolism
    CLH_0735
Enzymes [BR:cbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLH_0735
Protein phosphatases and associated proteins [BR:cbt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CLH_0735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(758686..759903)
Genome map
AA seq 405 aa AA seqDB search
MSNCIIAQSGGPTSVINSSVVGLIHANKSLKVFDKVYGGLNGIEGILNKNIIDLTLINDD
ELQTFRYTPSSGLGSCRYKLQNPNNSCDEYEKLVEILTEYDISSFFYIGGNDSMDTIAKL
SAYSKKNNIDINFIGIPKTIDNDLMFTDHTPGFGSAAKFITTSVLETYLDSSVYINNGIF
ILETMGRDTGWLAASACLAKIDDKPVADFIYLPETAFDKYQFINDVRQKFKEQNKVYIVV
SEGIKDETGKFISEFQCVSNDNFGHAQLGGVSQYLRNLILDAGITKRVKALELGILQRCA
MHFASDSDLNEAYDVGYVALQSAVNNESGKMVAIKRDDSKDYKSSYFLVDADKVANNVRY
FPSEWINEDGNFLKEEACEYFSPLVKNIPNLKIENNLPKYKVFNA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtctaattgtattattgcacaatctggtggtccaacttctgttattaattctagtgta
gtaggattaatacacgctaataaatcacttaaagtttttgataaagtctatggtggttta
aatggtattgaaggaattttaaataagaatataatcgatcttaccctaattaatgatgat
gagttacaaacttttagatacacaccatcttctgggttaggatcttgtagatataaatta
caaaatcctaataattcttgtgatgaatatgaaaaactagtagaaatattaacagaatat
gatataagttcatttttttatataggtggaaatgattctatggatacaatcgctaaactt
tctgcttattctaaaaaaaataatattgatataaactttattggtattcctaaaacaatt
gataatgatttaatgtttactgatcatacccctggttttggcagtgctgcaaaattcatt
acaacatcagtattagaaacttatcttgattcttctgtatatattaacaatggtatcttt
atattagaaacaatgggccgagatacaggttggctagcagcttcagcttgcttagctaaa
atagatgacaagcctgttgctgattttatttacttacctgaaactgcttttgataaatat
caatttatcaatgatgttaggcaaaaatttaaagaacaaaataaagtatatattgttgta
tctgaaggtattaaagatgaaactggcaaatttatatctgagtttcagtgtgtttctaat
gataattttggacatgctcaattaggtggcgttagccagtatctaagaaatctaattctt
gatgctggtataactaaaagagtaaaggctttagaattaggaattttacaacgttgtgcc
atgcattttgcatctgattctgatttaaatgaagcctatgatgttggttatgtagcttta
caaagtgcagtaaataatgaaagtggtaaaatggttgctataaaacgtgacgattctaaa
gactataaatcatcttacttcttagtagatgctgataaagtagctaataatgttagatac
ttcccttctgaatggattaatgaggatggaaactttttaaaagaagaggcttgtgaatat
ttttcaccattagtaaaaaatattcctaatttaaaaatagaaaataacttaccaaaatat
aaagtttttaatgcataa

DBGET integrated database retrieval system