KEGG   Clostridium botulinum E3: CLH_0764Help
Entry
CLH_0764          CDS       T00767                                 

Definition
chemotaxis response regulator protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cbt  Clostridium botulinum E3
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:cbt02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:cbt02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
794865..795971
Genome map
AA seq 368 aa AA seqDB search
MSKIKVIVVDDSAFMRKMISEIIEEDNEIEVVAKLRNGRELIEKVDKFNPDIITLDLEMP
EMDGLETLKELHKKNKNYSIIMLSSLTTKGSEKTMECLENGAIDFITKPSGSISLDIRKV
QENLIEKIKSISRRSIRTRAINKSVDVPKAVIKNTNVYNNAKVKDLKKPEHTNMVTIKNK
KIDAIVIGASTGGPKALQQLLTKFEANIGVPIFVVQHMPQGFTKAFSERLNKICNLKVLE
GEEGLRIENNVIYIAKGGYHMTVGTDGKIHLNEEDPIWGVRPAVDKLFDSAIKAYRGNLI
SVVLTGMGRDGAKGTSNVKDYGGVTISEDESTCTIYGMPKAAFETGKVDLVLPLNNICDE
VTKIVKKR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaaaataaaagttatagttgttgatgactctgctttcatgagaaaaatgatatca
gaaataatagaagaagataatgaaatagaggtcgtagctaaattaagaaacggaagagag
cttatcgaaaaagttgataaatttaatccggatattataacattggatttagaaatgcct
gaaatggatggactagaaacattaaaagagttacataaaaagaataagaattattctata
ataatgttaagtagtttaacaacaaaaggttcagaaaaaacaatggagtgtttagaaaat
ggagcaattgattttattactaaaccatcaggaagtatatcattagatataagaaaagtt
caagaaaatcttattgaaaaaattaaaagtatatctagaagaagtataagaactagggcg
attaataaatcagtagatgttcctaaagctgtaataaaaaatactaatgtgtataacaat
gcaaaagtaaaagatttaaagaaacctgaacatacaaatatggttacaattaaaaataaa
aagattgatgccattgttattggggcatctactggtggtccaaaagcacttcaacaatta
ttaactaaatttgaagcaaacattggagtgccaatatttgttgtgcaacacatgccacaa
ggatttacaaaagccttttctgaaagattaaataagatttgtaatcttaaagtcttagag
ggtgaagaagggctaagaatagaaaacaatgtgatatacattgccaaaggtggctatcat
atgacagttggtacagatggaaaaattcatcttaatgaagaagatccaatatggggtgtt
aggccagctgtagataaactttttgattcagccataaaagcatatagaggtaatttaata
tctgtagtgttaacaggaatgggtagagatggagctaaaggtacaagcaatgtaaaagat
tatggtggtgtcactatatcagaagatgaatctacttgtactatttatggaatgcctaag
gcagcatttgagactggaaaagtagatttagttttaccacttaataatatatgtgatgaa
gtaactaagattgtaaagaaacgttag

DBGET integrated database retrieval system