KEGG   Clostridium botulinum E3: CLH_0764Help
Entry
CLH_0764          CDS       T00767                                 

Definition
chemotaxis response regulator protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cbt  Clostridium botulinum E3
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cbt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CLH_0764
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    CLH_0764
Enzymes [BR:cbt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     CLH_0764
Two-component system [BR:cbt02022]
 CheA family
  CheA-CheYBV
   CLH_0764
Bacterial motility proteins [BR:cbt02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CLH_0764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
794865..795971
Genome map
AA seq 368 aa AA seqDB search
MSKIKVIVVDDSAFMRKMISEIIEEDNEIEVVAKLRNGRELIEKVDKFNPDIITLDLEMP
EMDGLETLKELHKKNKNYSIIMLSSLTTKGSEKTMECLENGAIDFITKPSGSISLDIRKV
QENLIEKIKSISRRSIRTRAINKSVDVPKAVIKNTNVYNNAKVKDLKKPEHTNMVTIKNK
KIDAIVIGASTGGPKALQQLLTKFEANIGVPIFVVQHMPQGFTKAFSERLNKICNLKVLE
GEEGLRIENNVIYIAKGGYHMTVGTDGKIHLNEEDPIWGVRPAVDKLFDSAIKAYRGNLI
SVVLTGMGRDGAKGTSNVKDYGGVTISEDESTCTIYGMPKAAFETGKVDLVLPLNNICDE
VTKIVKKR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaaaataaaagttatagttgttgatgactctgctttcatgagaaaaatgatatca
gaaataatagaagaagataatgaaatagaggtcgtagctaaattaagaaacggaagagag
cttatcgaaaaagttgataaatttaatccggatattataacattggatttagaaatgcct
gaaatggatggactagaaacattaaaagagttacataaaaagaataagaattattctata
ataatgttaagtagtttaacaacaaaaggttcagaaaaaacaatggagtgtttagaaaat
ggagcaattgattttattactaaaccatcaggaagtatatcattagatataagaaaagtt
caagaaaatcttattgaaaaaattaaaagtatatctagaagaagtataagaactagggcg
attaataaatcagtagatgttcctaaagctgtaataaaaaatactaatgtgtataacaat
gcaaaagtaaaagatttaaagaaacctgaacatacaaatatggttacaattaaaaataaa
aagattgatgccattgttattggggcatctactggtggtccaaaagcacttcaacaatta
ttaactaaatttgaagcaaacattggagtgccaatatttgttgtgcaacacatgccacaa
ggatttacaaaagccttttctgaaagattaaataagatttgtaatcttaaagtcttagag
ggtgaagaagggctaagaatagaaaacaatgtgatatacattgccaaaggtggctatcat
atgacagttggtacagatggaaaaattcatcttaatgaagaagatccaatatggggtgtt
aggccagctgtagataaactttttgattcagccataaaagcatatagaggtaatttaata
tctgtagtgttaacaggaatgggtagagatggagctaaaggtacaagcaatgtaaaagat
tatggtggtgtcactatatcagaagatgaatctacttgtactatttatggaatgcctaag
gcagcatttgagactggaaaagtagatttagttttaccacttaataatatatgtgatgaa
gtaactaagattgtaaagaaacgttag

DBGET integrated database retrieval system