KEGG   Clostridium botulinum E3: CLH_0913Help
Entry
CLH_0913          CDS       T00767                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cbt  Clostridium botulinum E3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CLH_0913 (malQ)
Enzymes [BR:cbt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CLH_0913 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
942496..943983
Genome map
AA seq 495 aa AA seqDB search
MRRSSGIIMHIASLPGEFGIGTFGKEAYEFADFLKESHQKYWQILPIGPTSYGDSPYQSF
SAFAGNPYFIDFKLLEDDGLLEGKDYLNLNFGEDEEDIDYGLIFVEKMKVLRKAYERFKL
NLPIDLKEFEEENQWLDDYSLYMAIKLKFELKSWQKWDIDIKLRKKEVLDKYREELKDEI
NYWKFIQYKFFEQWNNLKEYVNDLGIEIIGDIPIYVAEDSADIWANPKAFLLDEETLLPL
RVSGCPPDNFAVTGQLWGNPIYNWDYIDKTNYKWWIDRMRQSSKLYDVIRIDHFRGFESY
WSIPYGDPTAENGEWVKGPGIKLFNAIKKELGDIKIIAEDLGFLTDEVVKFREKSGFPGM
RVLQFAFSGDATNRDLPHNYEENCIAYTGTHDNNTFRGWLEKTGTEEEIEASIKYLGLNK
EEGYNWGFIRGVWGSKAYLSIALIQDFLNLGNESRINIPSTLGKNWRWRIKKDVFTDELA
EKIYEITKMYGRCEE
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagaagaagcagtggaatcataatgcatattgcatctttgccaggggaatttggaata
ggaacatttggaaaagaggcatatgagtttgcagattttttgaaagaatcacatcaaaag
tattggcaaatacttcctatagggccaactagttatggagattcaccatatcaatctttt
tcagcatttgcaggaaatccttattttatagattttaaactattagaagatgatgggtta
ttggaaggtaaagactatttaaatttaaattttggagaagatgaagaagatattgattat
ggattaatatttgtagaaaaaatgaaggttctaagaaaagcgtatgagaggtttaaactt
aatttaccaatagatttaaaagaatttgaagaagaaaatcagtggttagatgattattct
ttatatatggcaattaaattaaaattcgaattgaagagttggcaaaagtgggacatagat
attaaacttagaaaaaaagaagtattagataagtatagagaagaattaaaagatgaaata
aattattggaagtttatacaatataaattttttgaacaatggaataacttaaaagaatac
gtaaacgatttgggaattgaaataataggagatattccaatatatgtagcagaagacagt
gcagatatatgggcaaatccaaaagcatttttattagatgaagagacattattaccatta
agagtttcaggatgtccaccagataattttgcagtaacaggtcaattatggggaaatcca
atttacaattgggattatattgataaaactaattataaatggtggatagatagaatgaga
caaagttcaaaattgtatgatgttataagaatagatcattttaggggatttgaatcttat
tggtcaataccatatggagatccgacagcagaaaatggagaatgggtaaaaggtccagga
ataaaactctttaatgccataaagaaagagcttggtgatataaagattatagcagaagat
ttaggttttttaactgatgaagttgtaaaatttagagaaaaatctggttttccagggatg
agggttcttcaatttgccttttcaggagatgctacaaatagggacttacctcataactat
gaagaaaattgtatagcttatacaggcactcatgataataatacatttaggggatggctt
gaaaagacaggaactgaagaagaaatagaagcttctattaaatatctagggttaaataaa
gaagaaggatataattggggatttataagaggagtatggggtagcaaagcatatttatca
atagccctaatacaagattttctgaatttgggaaatgaatctagaattaatattccttca
acacttggaaaaaattggcgttggagaattaaaaaagatgtttttacagatgaattagca
gaaaaaatttatgagataacgaaaatgtatggaaggtgcgaagaataa

DBGET integrated database retrieval system