KEGG   Clostridium botulinum E3: CLH_0956Help
Entry
CLH_0956          CDS       T00767                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cbt  Clostridium botulinum E3
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cbt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
997324..997920
Genome map
AA seq 198 aa AA seqDB search
MYEYIKGEYMGINKDYIIIENNGIGYKIFTSGATMSSMPCCGEKIKIYIEQIVREDFIGL
YGFESLEELDMFKLLLSINGVGAKAALSLLSISRLNNLKYAIITGDEKHLCRGTGIGKKI
AGRIILELKDKLKSDELLNCIDEFDDVTQDNSLALSEALSALISLGYTEKEAEKVLKDVD
KSESVENIIKSALVKLMG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaatatataaaaggtgaatatatggggataaataaagattatatcattattgaa
aataatggaattggatataagatatttacttcaggtgcaaccatgtcttcaatgccatgc
tgtggtgaaaaaataaaaatatatattgaacagattgtaagagaagactttataggttta
tatggatttgagtctttagaagaattagatatgtttaagttgctacttagtataaatggt
gttggagctaaggctgctttatcattattatctataagtcgtttaaataatttaaaatat
gcgataattactggagatgaaaaacatctttgtagaggcactggtataggtaagaagatt
gctggtagaatcatattagaattaaaagataagttgaaatcagatgagctattgaattgt
atagatgaatttgatgatgtaacacaagataattctcttgcactttcagaagcattaagt
gcattaatttctttaggatatacagaaaaagaagcagaaaaagtgcttaaagatgtggat
aagtcagaaagtgttgaaaatattataaagagtgcattagttaaattgatgggataa

DBGET integrated database retrieval system