KEGG   Clostridium botulinum E3: CLH_1368Help
Entry
CLH_1368          CDS       T00767                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cbt  Clostridium botulinum E3
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CLH_1368
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CLH_1368
Enzymes [BR:cbt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CLH_1368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1465097..1466728
Genome map
AA seq 543 aa AA seqDB search
MCFKICKDGEKMKSTSNKQWKLIVTMVLMLILVSVSIEMIFKGNNQSKAIFAAENSNNDI
IPKPLSYKVGEGNFIITKDTSIYVKGNTKEETEEISKIAEFIREKLRASTGFELNIIQGK
EGKSGSIYLTTIGSKESQGNEGYEIVTTPKNVKIVAYKAEGISRGVQTLRQLLPPDIEKN
TIANDVEWNIPVSIINDEPEYNYRGLMIDVARHFFTIDEVKRQIDYAAQYKINRVHLHLS
DDQGWRLEIKKYPDLTIIGGSTEVGGGKGGYYTQEEFKELVKYAAERYVEIIPEFDMPSH
SNAALASYGFLNKDGKRRPLYTGTDVGFSSFMAHSEETYEFIEDVIKEVSKISPSKYIHI
GGDEANSTKKEDYDYFVGKVSKMAEKYGKTPIGWDPIDTSPEINSSVILQNWKDSNEAAR
KKEMKMVISIAQKAYLDMKYNDNTPYGLTWAGYIPVETAYKWDPTDYAPKELVLGIEAPL
WTETISDTKAMDYMIYPRLLGYAEIGWTPKENRDWNQYKNRLKKQGERMKNQGINYYKDS
SIW
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtgttttaaaatatgtaaggatggtgaaaaaatgaagagtacatctaataagcagtgg
aagttgatagtgacaatggtgttaatgctaatattagtaagtgtttctattgaaatgatt
tttaaaggaaataatcaatcaaaagcaatttttgcagcagaaaatagtaataatgatatt
attccaaaacctttaagttataaagttggcgagggtaattttataattacgaaggatacc
tcaatttatgtaaaaggaaatactaaagaagagacagaggagattagtaagattgcagag
tttataagagaaaaattaagggcttcaactggatttgaattaaatattattcaaggaaaa
gaaggcaaatcaggtagtatttatttaactactataggatcaaaagaaagtcaaggtaat
gaaggttatgaaatagtaactacacctaaaaatgttaaaatcgtagcgtataaggcagaa
ggtatttcaagaggagttcaaacactaagacaattattgccaccagatattgaaaaaaat
actatagctaatgatgtagaatggaatattccagtttcaataataaatgatgaacctgaa
tataattacagaggattaatgattgatgtggctaggcacttttttactatagatgaagtt
aaacgtcagatagattatgcagctcaatataaaataaatagagttcatttacatcttagt
gatgatcaaggatggcgtttagaaataaaaaaatatcctgacttaactataataggtgga
agtacagaagttggtggaggaaaagggggatattatacacaagaagaatttaaggagtta
gttaaatatgcagcagaaagatatgtagaaataattcctgagtttgatatgccaagtcat
agtaatgctgcactagcttcttatggatttttaaataaagatggaaaaagaagacctttg
tatacaggaactgatgtaggttttagttcttttatggcacatagtgaagagacatatgaa
tttattgaagatgttatcaaagaagtttctaaaatatctccttcaaaatatattcatata
ggtggagatgaggctaatagcactaaaaaagaagattatgattattttgtaggaaaagta
tctaaaatggctgagaagtatggaaaaactccaatagggtgggatccaattgatacatct
ccagaaatcaattcaagtgtaatattgcaaaattggaaagattctaatgaagcagctagg
aaaaaagaaatgaaaatggttatttcaattgcacaaaaagcttatttggatatgaaatat
aatgataatacaccatatggattaacatgggcaggttacattccagtagaaactgcatat
aaatgggatcctactgattatgcaccaaaggaattggttttaggtatagaagcaccatta
tggacagaaacaatttctgatacaaaagctatggattatatgatatatccaaggttatta
ggttatgctgaaattggatggacaccaaaagaaaatagagattggaatcagtataaaaac
agactgaagaaacagggagaaaggatgaaaaatcaaggaataaattattataaagatagc
agtatatggtga

DBGET integrated database retrieval system