KEGG   Clostridium botulinum E3: CLH_1388Help
Entry
CLH_1388          CDS       T00767                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K00132  
acetaldehyde dehydrogenase (acetylating) [EC:1.2.1.10]
Organism
cbt  Clostridium botulinum E3
Pathway
Pyruvate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLH_1388
   00650 Butanoate metabolism
    CLH_1388
Enzymes [BR:cbt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CLH_1388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1483506..1485065
Genome map
AA seq 519 aa AA seqDB search
MENFDRDLCSIQEARNLARLGKVAAEKIADYTEEQIDKILCNMVKVAEANAVCLAQMAVE
ETGFGKVEDKTYKNHMASTILYDSIKDMKTIGIIKEDEANKLIELAEPVGLVMGIVPSTN
PTSTAIFKAMIAIKSRNAIVFSPHPSAAQCTIKAAKLMNEAAIEAGAPENIIGCVSTPTI
GATNELMKSKEVAIIIATGGPGMVKAAYSSGKPALGVGAGNSPAYIERSANVEKAIRNII
ASKTFDNGTICASEQSIICEECNHDEVVAELKKQGGYFMTAEETDKVCNLLFKNGHSMNA
KFVGRSPQVIASSAGISIPQDTKVLIGEQKGVGEGYPLSFEKLTTVLAFYTVKDWHEACE
LSIELLQNGIGHTMSIHTEDRDIVMKFARKPASRILVNTGGSQGGTGASTGLIPSFTLGC
GTWGGSSVSENVTPMHLINIKRVAYGLKDCATLASNDTTFNHIKTENNCHHTQNQCGSLS
PDQYAAASKCINTDDIKNANNEELLDMINKLVKVMKGEA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggagaattttgatagagatttgtgttcaatacaagaagcaagaaaccttgctcgctta
ggaaaagttgcagcagaaaaaattgctgattatactgaagaacaaattgataaaatttta
tgcaacatggttaaggttgcagaagcaaatgctgtttgcttagcacaaatggcagtagaa
gaaactggtttcggtaaggttgaagataaaacttataagaatcatatggcatctactata
ttatatgattcaattaaagatatgaaaactattggtattataaaagaagatgaggctaat
aagttaatagaacttgctgaacctgttggattagtaatgggaatagtaccttcaacaaat
ccaacgtctacagctatttttaaagcaatgattgctataaaatctcgtaatgcaatagta
ttttcaccacatccatcagcagcacaatgtacaataaaagcagctaaattgatgaatgag
gcagctatagaagctggggctccagaaaacattattggttgtgtttctactccaacaatt
ggagctacaaatgaattaatgaagagcaaagaagttgctataataatagcaacaggcggt
ccaggaatggtaaaagctgcttatagttcaggaaaaccagcacttggagtaggggcagga
aactctccagcatatatagaaagaagtgcaaatgttgaaaaagctataagaaatattatt
gcaagtaaaacatttgataatggtacaatctgtgcatcagagcaatctattatatgtgaa
gaatgtaatcatgatgaagtagttgcagaattaaagaaacaaggcggatatttcatgaca
gcagaagaaaccgataaagtttgtaatctgttatttaagaatgggcatagcatgaatgct
aaatttgtaggtagatctccacaagttatagcgagttcagcaggaatttctattccacaa
gatacaaaggtacttataggagaacaaaagggtgttggtgaaggttatccattatctttt
gaaaaacttacaacagtacttgcattttatacagtaaaagattggcatgaagcatgtgaa
ttaagtattgaattacttcaaaatggaataggacatacaatgagtattcatactgaagat
agagatatagtaatgaaatttgctagaaagccagcatcacgtattttagttaatactggt
ggtagccaaggtggaacaggtgcaagcacaggacttataccatcatttacattaggttgt
ggtacttggggcggtagttcagtttctgaaaatgttaccccaatgcacttgattaacatc
aagagagttgcttatggtttaaaagattgtgcaacattagcttctaacgatacaacgttc
aatcatattaaaacagaaaataattgtcaccatacacaaaatcaatgtggaagcttaagt
cctgatcagtatgcagctgcatcaaagtgcatcaatactgatgatattaaaaatgctaac
aatgaagaacttttggatatgattaataagttagttaaggtgatgaagggggaagcatag

DBGET integrated database retrieval system