KEGG   Clostridium botulinum E3: CLH_1551Help
Entry
CLH_1551          CDS       T00767                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cbt  Clostridium botulinum E3
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cbt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLH_1551
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLH_1551
   00052 Galactose metabolism
    CLH_1551
   00500 Starch and sucrose metabolism
    CLH_1551
   00520 Amino sugar and nucleotide sugar metabolism
    CLH_1551
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CLH_1551
   00524 Butirosin and neomycin biosynthesis
    CLH_1551
Enzymes [BR:cbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CLH_1551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1662296..1662937
Genome map
AA seq 213 aa AA seqDB search
MKYYIGIDIGGTNLRAAILDEECNLVDKLKISNEVEEGPEYNLDKLILEIKERWSDKEII
SVGVGCPGPLDIRSGTILVTPNLRTWEYFKLKEYLENKFDLPVFVNNDANVAGYSEAMVG
AGKGAEKGNMELQKMLSEWVINVSKAIANIIVTVDPEVIVLGGSVIINNPSYLNKIKEET
QKRVFDGIKINIKLAEIGDDTGLIGAGLLGKLK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattacataggtatagatataggcggaacaaacttaagagcagcaatattagat
gaagaatgtaacttagtagataagcttaaaatatcaaatgaagttgaagaagggccagaa
tataatttagacaagctaatattagaaattaaagaaaggtggtcagataaagaaattatt
tcagtaggtgtggggtgtccaggaccacttgatattagaagtggaacaatattagttact
ccaaatttaaggacatgggaatattttaaattaaaagaatacctagaaaataagtttgat
ttacctgtgtttgtaaataatgatgccaatgtagcaggatatagtgaagcaatggttgga
gcaggaaaaggtgcagaaaagggcaatatggaattgcaaaaaatgttaagtgaatgggtt
ataaatgtttcaaaagcaatagcaaatattatagttacagttgatccagaagttatagtt
cttggtgggtcagtaattataaataatccatcttaccttaataagattaaagaagaaact
cagaaaagagtctttgatggtattaaaattaatattaagttagctgagattggtgatgac
actggacttataggtgcagggttattaggtaagttaaaataa

DBGET integrated database retrieval system