KEGG   Clostridium botulinum E3: CLH_1805Help
Entry
CLH_1805          CDS       T00767                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cbt  Clostridium botulinum E3
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLH_1805 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLH_1805 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CLH_1805 (trpB)
Enzymes [BR:cbt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CLH_1805 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1933753..1934970)
Genome map
AA seq 405 aa AA seqDB search
MDFRTYLKRYPDKNGRFGQYGGAYLTNELIPAFEEIADAYQTICHSSQFISELRRIRKEF
QGRPTPVYHCERLSRAIGNCQIYLKREDLNHTGAHKLNHCMGEGLLAKFMGKKRLIAETG
AGQHGVALATAAAFFGLECEIHMGEVDIAKQAPNVTRMKILGAKVVPVTHGLKTLKEAVD
SAFDSYAKNYKDSIYCIGSALGPHPFPLMVRDFQAVVGYEAKDQFKEMTGFLPDVVTACV
GGGSNAAGMFIPFLEEPVDIIGIEPLGRGEKLGDHAASMKYGEKGVMHGFESIMLKDKNG
NPAPVYSIASGLDYPSVGPEHAFLRELGRVDYKVINDEEAMEAFFKLSRYEGIIPAIESS
HAVAYAMKKAKEMKQGSILVCLSGRGDKDIDYVVEHYGYGEQYFK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggattttcgaacatatttaaaaaggtatccagataaaaatggtcgttttggtcaatat
ggtggggcatatttaacaaatgaattaattccagcatttgaggagattgctgatgcatat
caaactatttgtcattcttcacagtttattagtgaacttagaagaattcgtaaggaattt
caaggtagacctacacctgtttatcattgtgaaagattatctagagcaatagggaattgt
caaatttatttaaaaagagaagatttaaatcatacaggagcacataaattaaatcattgt
atgggtgaaggattacttgctaaatttatggggaaaaagcgtttgattgcagaaacagga
gcaggacaacatggagttgcccttgcaacagctgctgcattttttggattagaatgtgaa
atccatatgggagaagtagatattgcaaagcaagcgcctaatgtgactagaatgaaaata
ttaggggctaaagttgttccggtaactcatggtttaaaaactttaaaagaagctgtggat
tctgcttttgattcatatgctaaaaattacaaggattcaatttattgtatagggtcagca
ttagggccacatccatttccacttatggtaagagattttcaagctgttgttggatatgaa
gctaaagatcaatttaaggaaatgacaggttttttaccagatgtggttactgcgtgtgta
ggtggtggaagcaatgctgctggaatgtttataccatttttagaagaaccagttgatata
attggaatagagccattaggtagaggtgaaaaattaggcgatcatgctgcttctatgaag
tatggggaaaaaggagttatgcatggatttgaaagtataatgttaaaagataaaaatggt
aatccggcaccagtatattctatagcaagtggacttgattatccatcagttggtcctgaa
catgcatttttaagagaattaggacgtgtagactataaagttataaacgatgaagaggct
atggaagctttctttaaattatcaagatatgaaggaattatacctgcaattgaaagttca
catgctgttgcatatgcaatgaaaaaagctaaagaaatgaaacaagggtctattttagtc
tgtttaagtggacgtggtgataaagatattgattatgttgttgaacattatggatatgga
gaacaatattttaaataa

DBGET integrated database retrieval system