KEGG   Clostridium botulinum E3: CLH_1862Help
Entry
CLH_1862          CDS       T00767                                 

Definition
lysophospholipase l2 pldb, hydrolase of alpha/beta superfamily
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
cbt  Clostridium botulinum E3
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:cbt00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1990004..1991119)
Genome map
AA seq 371 aa AA seqDB search
MNLLKYKRNINYKVLLFLLIFTLNIIFGVNQNQIAYADENEKTAINSLVIEEDDYEESMK
GLVEPYLNSKRTEGYFKVNDDINLYYQQYKVENSKGTIVISHGFTETLEKYKEMIYYFLN
KGYSVYGIEHRGHGRSGSLGVVDESQIHIEDFNLYVSDFKSFIDDIVKPEIGSQKLFLFA
HSMGGAIGTKFLEEYPGYFDAAILSAPMLEVNTGSVPSFLAKSISWICTNISLGHKYAPT
QKPYSNEYNLEDSCTSSEARYKYYYDIQSSNKEFQRGGSSFSWLNSSLDITKEITKKENA
SKVEIPVLLFQAEKDTYVKPKGQNEFSQYAPNCKLILMVGSKHEVYREKDGILKAYLNQV
FDFYNDNLSDS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgttaaagtataaaagaaatataaattataaggtattattatttttattaata
tttactctaaatataatatttggagtaaatcaaaatcaaattgcttatgctgatgaaaat
gaaaaaacagcaattaatagtttagtaatagaagaagatgattatgaagagtctatgaaa
ggcttagtagagccatatcttaatagtaaaaggacagaaggatattttaaagtaaacgat
gatattaatctttattatcaacaatataaagttgagaattctaaaggtactattgtaatt
agccatggattcactgaaacattagaaaaatataaagaaatgatttattactttttaaat
aaaggatattctgtttatggaattgaacatagagggcatggacgctctggttcattagga
gttgtggacgaaagtcaaattcatatagaagattttaatttatatgtttcagattttaaa
tcgtttatagatgatattgttaaacctgaaattggtagtcaaaaattatttttatttgca
cattctatgggtggtgcaattggaactaaatttttagaagaatatccaggatattttgat
gctgctattttaagtgcaccaatgcttgaagttaatactggcagtgttcctagtttttta
gctaaatctatatcttggatatgtacaaatatatctttaggacataaatatgcacccaca
caaaaaccatatagtaacgaatataatttagaagattcgtgtacaagctctgaagcaaga
tacaagtattattatgatatacaatctagcaacaaagaatttcaaagaggtgggtcttca
tttagctggttaaactcatctttagatataacaaaagaaattactaaaaaagaaaatgct
tcaaaagtagaaataccagtgttgttatttcaagctgaaaaagatacttatgtaaaacca
aaaggacaaaatgaattttctcaatatgcacctaattgtaaacttatattaatggtagga
tctaaacatgaagtatatagagaaaaagatgggatattaaaagcatatttaaatcaagta
tttgatttttataatgataatttatcagatagttaa

DBGET integrated database retrieval system