KEGG   Clostridium botulinum E3: CLH_2045Help
Entry
CLH_2045          CDS       T00767                                 

Gene name
pfkB
Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
cbt  Clostridium botulinum E3
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:cbt00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CLH_2045 (pfkB)
Enzymes [BR:cbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     CLH_2045 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2195476..2196378)
Genome map
AA seq 300 aa AA seqDB search
MINTITLNPSLDYIVKVDNFKIDSLNRSNDEDVYAGGKGINVSIVLNNLGIENTALGYVA
GFTGNEIERQVKNHGVDCDFIKLKSGISRINVKLKSNGETEINGSGPEITNDDLNKLYEK
LSELKEGDYLILSGSIPNSVPDDIYQNIMEKLLQKKVEFIVDATKDLLLKVLKYEPFLIK
PNHHELAEMFNVELKNDEDIIIYGRKLQEMGAKNVLISMAGDGAILLPENGEPIKREVPK
GILKNSVGAGDSMVAGFLAGYLKNNDIKEAFKMGIATGSASAFSDELATKEEVEKLLSKI
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgattaatacaataacacttaatccttcattggattatatagtaaaggttgataatttt
aagattgattcattaaatagaagcaatgatgaagacgtttatgcaggaggaaaaggaata
aatgtttctatagtcttaaataatttaggaatagagaatacagcattgggttatgttgca
ggttttacaggaaatgaaatagaaagacaagtgaaaaatcatggtgttgattgtgatttt
ataaaattaaaaagtggtatatctcgaattaatgtaaaactaaaaagtaatggagaaaca
gaaataaacggttcaggtccagaaattacaaatgatgatttaaataaattatatgaaaag
ctttctgaattaaaagaaggagattatttaatattgtcaggtagtattcctaatagtgta
ccagatgatatttatcaaaatataatggaaaaacttttacaaaagaaagtagaatttata
gttgatgcaacaaaagatttacttttaaaagtactaaagtatgagccatttctaataaaa
cctaatcatcatgaattagctgaaatgtttaatgttgagctgaaaaatgatgaagatata
ataatttatggtagaaagcttcaagaaatgggagcaaagaatgtattgatttcaatggct
ggagatggagcaattttattacctgaaaatggagaacctataaaaagagaagtgccaaag
ggaatattaaaaaactcagtaggagctggagattctatggtggctggatttttagcagga
tatcttaaaaacaatgatataaaagaagcattcaaaatgggaattgcaacaggtagtgca
agtgcattttctgatgaattagcaacaaaagaagaagttgaaaaactattatctaaaatt
taa

DBGET integrated database retrieval system