KEGG   Clostridium botulinum E3: CLH_2300Help
Entry
CLH_2300          CDS       T00767                                 

Gene name
fbp
Definition
fructose-1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
cbt  Clostridium botulinum E3
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cbt01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cbt00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cbt00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cbt00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:cbt00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2467374..2469353)
Genome map
AA seq 659 aa AA seqDB search
MNNNDVEDIKKLKYFRLLAKQYPNIALAATEIINLEAILNLPKGTEHFLSDIHGEYEPFV
HVLRNGSGVVKRKIEDLFCKSLLESDIKSLATLIYYPEQKLDIVLKEERNIDDWYKITLN
RLIEICRFCSSKYTRSKVRKALPADFAYIIEELLHEQFNGIDKEEYYDRIITTIIDIGRA
KEFIIALSKLIQRMIIDRLHIIGDIYDRGPRPDIIIDTLMEYHSVDIQWGNHDMLWMGAA
AGVRTCVANVLRISTRYANLDLVEEIYGINLLPLATFALKYYRDDPCESFIPKVKEDDPA
ANQEVDLVSKMHKAITILQFKLEKEIIDRRPEFELEERLLLDKIDYEKGTIILNGTEYKL
NDNNFPTIDPKDPYKLTEEESVLIDKLVYSFVNSDKLQKHVRFLFSKGNMYLKFNSNLLF
HGCIPLDDDGNLKSMWIQGEEYESKRLLEKFDSLSREGYFEKVGSEEKTYGMDIMWYLWT
GPVSPLFGKKKMATFERYFIDDEIAHIEQKTGYYKLRDREEMCDMILREFGLDPSESRII
NGHVPVKKKNGESPIKANGKMIVIDGGFSKAYQKQTGIAGYTLIYNSYGLQLVSHEHFSS
TEESIMKEKDILSTTLVVEQKLKRKTVEDTDIGKELQVQIKDLKELLLIYRKGIIKEIR
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgaataataatgatgtggaagacataaaaaaactaaagtattttagattactagccaag
cagtatcctaatattgctttagccgctacagaaattataaatttagaagcaattcttaat
ttacctaaaggtacagaacattttttaagtgatatacatggtgaatatgagccatttgta
catgtactaagaaatgggtctggcgtggtaaaaagaaagatagaagatcttttttgcaaa
tctttattagaaagtgatataaagagtttagcaactttaatatattatccagaacaaaaa
ttggatatagttttaaaagaagaacgtaatatagatgattggtataaaataacgttaaat
agacttatagaaatatgtagattttgttcatctaaatatacaagatctaaagtgagaaag
gctttaccagctgattttgcttatataatagaggaattattacatgaacaatttaatggt
atagataaagaggagtattacgatagaataataactacaattatagatataggaagagca
aaagaatttataattgcattatcaaagcttattcaaagaatgattattgataggcttcat
ataataggggatatatatgatagaggcccaagaccagatattataatagatacccttatg
gaatatcattctgttgatattcagtggggcaatcatgacatgctttggatgggagcagct
gcaggagtaagaacttgtgttgctaatgttttaagaatatctacaagatatgcaaatttg
gatttagttgaagaaatttatggaataaatctgttaccactagcaacatttgcattaaag
tattatagggatgacccatgtgaatcatttattccaaaagtaaaggaagatgacccagct
gcaaatcaagaagtagatttagtatctaaaatgcataaagctataacaatattacagttt
aaactagaaaaagagataatagatagaagaccagaatttgaattagaagaaagattgtta
ctagataaaatagattatgaaaaaggaactataatattaaatggaactgaatataaatta
aatgataataatttcccaacaatagatcctaaagatccatataaacttacagaggaagaa
tcagtacttatagataaacttgtgtattcttttgtaaatagtgataaattacaaaaacat
gttagatttttattttctaaaggaaatatgtatttaaagtttaattctaatttattgttt
catggttgtataccattagatgatgacggaaatttaaaaagtatgtggatacaaggtgaa
gaatatgaaagtaaaagattattagaaaaatttgattctttatctagagaaggttatttt
gaaaaagttggaagtgaagaaaagacttatggaatggacataatgtggtatttatggaca
ggccctgtatcacctttgtttggtaaaaagaaaatggctacatttgaaaggtattttata
gatgatgaaatagctcatatagaacagaaaacaggatattataaactaagagatagagaa
gaaatgtgtgatatgatacttagagaatttggattagatccaagcgaatctaggattata
aatggacatgtaccagtaaaaaagaaaaatggagaaagtccaataaaggctaatggtaaa
atgatagttattgatggtggattttctaaggcataccaaaaacagactggcatagcagga
tatacattgatatataattcttatggattacaattagtttcacatgaacacttctcatct
acagaagaatctataatgaaagaaaaagatattctatctacaactcttgtagtagagcaa
aagctcaaacgaaaaacagtagaagatacagatataggtaaggagttacaagttcaaatt
aaagacttgaaggaattattattaatatatagaaaagggataataaaagaaataagataa

DBGET integrated database retrieval system