KEGG   Clostridium botulinum E3: CLH_2639Help
Entry
CLH_2639          CDS       T00767                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cbt  Clostridium botulinum E3
Pathway
cbt00260  Glycine, serine and threonine metabolism
cbt00750  Vitamin B6 metabolism
cbt01100  Metabolic pathways
cbt01110  Biosynthesis of secondary metabolites
cbt01120  Microbial metabolism in diverse environments
cbt01230  Biosynthesis of amino acids
Module
cbt_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cbt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLH_2639 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CLH_2639 (thrC)
Enzymes [BR:cbt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CLH_2639 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP EndoU_bacteria
Motif
Other DBs
NCBI-ProteinID: ACD52554
Position
complement(2792524..2793987)
Genome map
AA seq 487 aa AA seqDB search
MKFRSTRGLEHGVASAIAIINGISKDGGLYVPESFPNMYSSLKSKMEFSYEELAFEIING
YFTDIDDEDLKEAINEAYNKRFEVKVHNNFLELYHGPTCAFKDAALLFLPQIMKRAKKIC
NKEEDIVILAATSGDTGKAALEGFKNINGFKVVVYYPKKGVSAIQERQMITQKGNNVKVI
GINGNFDDAQRSVKEIFGDNDFKDNLLKKGVTLSSANSINIGRLVPQIVYYFYGYFDLVK
KGVIKQGEKINVVVPTGNFGNILASYYAKQMGLPIDKFICASNENKVLTDFFKSGIYDKR
RELVLTESPSMDILVSSNLERLLFEASGRNSEVINNLMNSLNEKGVYEINDDMKKFMKEF
YGEYATTEEVSDAIKEVYKKDNYLMDTHTAVGYVVKNKYQAETNDTKEVLIASTASPFKF
PRSICKALNISNDGIDDFEVLKKLSEITKNNIPKSLANLSEHEILHDEVWDKSEMKKALL
SYLGIEG
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttagaagtactagggggctagaacatggggtagcctctgcaatagcaataata
aatggaatttctaaagatggaggactttatgtacctgaaagttttcctaatatgtattca
tcattaaagagtaaaatggaatttagttatgaagaattagcatttgaaattattaatgga
tattttactgatattgatgatgaagatttaaaggaagcaattaatgaagcatataataag
aggtttgaagttaaggtacataataactttttagaattatatcatggtccaacttgtgca
tttaaggatgcagcattactatttcttccacaaataatgaaaagagcaaaaaagatttgc
aacaaagaagaagatatagtaatattagcagcgacatcgggtgatactggaaaagcggca
ttagaaggatttaaaaatattaatggatttaaagtagttgtatactatcctaaaaaaggt
gtaagtgctatacaagaaagacaaatgataactcaaaaaggcaataatgttaaagttatc
ggaataaacggcaattttgatgatgcacaaagatcagtgaaagaaatatttggagataat
gattttaaagataacctattaaagaaaggtgttactttatcatctgcaaattctataaat
ataggtaggttagttccacaaatagtatattatttttatgggtatttcgacttggtaaaa
aaaggggttataaaacaaggtgaaaaaattaatgtagtagttccaacaggaaactttgga
aatatattagcatcatattatgctaaacaaatgggacttcctatagataagtttatctgt
gcttcaaatgaaaataaagttttaacagatttctttaaaagtggtatttatgataagaga
cgtgaacttgtattgacagaatcgccatcaatggatatcttagtatcatctaatcttgag
agattattatttgaggcaagtggacgaaattcagaagttataaataatcttatgaattca
ttgaatgaaaagggcgtatatgaaataaatgatgacatgaaaaaatttatgaaagagttt
tatggagaatatgctacaacagaagaggtatctgatgcgataaaagaagtttataaaaaa
gataattacttgatggatactcatacagcagttggttatgttgttaaaaataaatatcaa
gcagagactaatgatactaaagaagtattaatagcttcaactgctagtccatttaaattt
ccaagaagtatttgtaaggcattaaatatttcaaatgatggaattgatgattttgaagta
ttaaaaaagttatctgaaattacaaaaaacaatatacctaagagtttggctaatttatca
gaacatgaaattcttcatgatgaagtttgggataagtcagagatgaaaaaagcattactt
tcttatcttggaattgaaggttaa

DBGET integrated database retrieval system