KEGG   Clostridium botulinum E3: CLH_2647Help
Entry
CLH_2647          CDS       T00767                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cbt  Clostridium botulinum E3
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cbt00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2801404..2802369)
Genome map
AA seq 321 aa AA seqDB search
MIKRGRRLRATSAIRDMIRETTLNTKDFIYPIFVVEGENIKNEICSLPDNYHYSIDRLHE
VIAEVEKANIAGVLLFGIPEHKDACGSEAYNDNGIVQQAVRKIKELNKELLVITDVCMCE
YTSHGHCGIIHESDVDNDETLEYLGKIAVSHAKAGADMVAPSDMMDGRIGFMRKALDDNG
FKKVSIMSYSAKYCSAFYGPFREAAGSAPEFGNRKTYQMDPANRLEALRETEKDIEEGCD
IIMVKPALPYLDVIRECRQNFNMPLAAYNVSGEYAMVKAAGKQGLIDEERIIMEILTSIK
RAGADIIITYHALEAAEILNR
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaagaggcagaagattaagagcaacatctgctattagagatatgataagagag
actacactaaatactaaggattttatataccctatatttgttgtagaaggagaaaatata
aagaatgaaatttgttctttaccagataattatcattattcaatagatagattacatgaa
gtaattgcagaagttgaaaaagctaacattgcaggagttcttttatttggtattccagag
cataaagatgcttgtggaagtgaagcatataatgataatggaattgttcaacaagctgta
agaaagattaaggaattaaataaggaactacttgttataacagatgtttgcatgtgtgaa
tacacatctcatggacattgtggaataattcatgaatctgatgtagataatgatgagaca
cttgaatacttaggaaaaattgcagtatctcatgcaaaagcaggagctgatatggtagcg
ccttcagatatgatggatggcagaattggatttatgagaaaagcattagatgataatgga
tttaaaaaagtgagtataatgagttattctgcaaaatattgctcagcattttatggacca
tttagggaggcagctggatcagcacccgaatttggaaatagaaaaacatatcaaatggat
ccagctaatagattagaagcattaagagaaacagaaaaagacatagaagaaggctgtgat
attataatggttaagccggcattaccttatttagatgtaataagagaatgcagacaaaac
tttaatatgcctcttgcagcttataatgtaagtggtgaatatgcaatggttaaggcagca
ggaaaacaagggcttatagatgaagaaagaataataatggaaattttaacttcaataaag
agagctggagcagatataataataacttatcatgcattagaagcggcagaaattttaaat
agatag

DBGET integrated database retrieval system