KEGG   Clostridium botulinum E3: CLH_2648Help
Entry
CLH_2648          CDS       T00767                                 

Definition
uroporphyrinogen III synthase/methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cbt  Clostridium botulinum E3
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cbt00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2802372..2803847)
Genome map
AA seq 491 aa AA seqDB search
MNKVYIIGTGPGDEELLTVKAVNKLKECTAVLYDRLVSNNILNYLSDSCEIYYCGKEPGA
HYKTQEEINEMLVKLAKEGHVVGRVKGGDPYVFGRGGEEVLALKEENIPFEVIPGVTSPI
AVLNYAGIPITHRGIAQSFHVVTGMSAKHIKSNFKALAMEEGTLVFMMGLSNLENIVHEL
VLNGKDISTPCGVVMRGTSSKQKKVVGTLENICKKVEEAKLQSPCIIVIGEVVNLNEDLA
WYEHKPLFGKNICVTRSQKQAATLKQKLRDMGAEVTALSAIEIESTANNLDSYMGDLENY
DHIVFTSVNSVDIFFDYLIENKYDIRKLQAKVSAIGKATWQALERRGIICFVKAREFIGA
GLIKVLKPHVKENEKVLIPCSSLAKSDIADELSNVGANVDRVFIYDTVKGRVRNKRAFDE
VDIVFFTSPSTVYNMIDMVGLDAIKEKQVIAIGTRTNKPLEELGIKAYICKEHSQDGFLN
EIESFVKDMEA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtatatattataggtacaggacctggagacgaagaattattaaccgtaaaa
gctgtgaataaattaaaagagtgtacagctgttttatatgatagattggtttcaaataat
attttaaattatttaagtgattcttgtgaaatttattattgtggaaaagaaccaggagca
cattataaaacacaagaagaaataaatgaaatgctagtaaaattagcaaaagaaggccat
gtagtgggaagagttaaaggcggagacccttatgtttttggaagaggaggagaagaggtg
ttagcgcttaaggaagaaaatattccttttgaagtaataccaggagtaacttctccaata
gcagtattaaattatgcaggtattccaataactcataggggaatagctcaaagttttcat
gttgtaactggaatgtcagcaaaacatattaagtctaatttcaaagcattagctatggaa
gaaggaactttagtatttatgatgggattaagcaacttagaaaacatagtacatgaactt
gtgttaaatggaaaagatatttctacaccttgtggcgttgttatgagaggaacttctagt
aagcaaaagaaggtagttggaactttagaaaatatatgtaaaaaagtagaagaagctaaa
ttacaatcaccatgtataattgttatcggtgaagtggttaatttaaatgaagacttagct
tggtatgaacataaacctttgtttggcaaaaatatttgtgtaactagatctcaaaagcaa
gcggctactttaaaacaaaagttaagagatatgggcgctgaagttacggctttaagtgct
atagaaatagaaagtacagctaataatttagatagctatatgggtgatttagaaaattat
gatcatatagtatttacctctgtgaattcagttgatatattctttgattatttaatagaa
aataaatatgatataagaaaattacaagctaaagtatcagctataggtaaagcaacatgg
caagctcttgaaagaagaggtataatatgttttgtgaaagctagagaatttataggcgct
ggattaataaaagtattaaaaccacatgttaaagaaaatgaaaaggtacttattccatgt
tcatcattagcaaagtcagatatagcagatgaattatctaatgtaggtgctaatgtagat
agagtatttatttatgatacagtaaaaggaagagtaagaaataaaagagcatttgatgaa
gtagatatagtattttttacaagcccatcaactgtatataatatgatagatatggttgga
ttagatgctattaaagaaaaacaagttatagcaataggcactagaactaataaaccactt
gaagaactaggaataaaggcatatatttgcaaggagcattcacaagacggattcttaaat
gaaattgaatcatttgtaaaagatatggaggcgtaa

DBGET integrated database retrieval system