KEGG   Clostridium botulinum E3: CLH_2812Help
Entry
CLH_2812          CDS       T00767                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cbt  Clostridium botulinum E3
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cbt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLH_2812 (tpiA)
   01230 Biosynthesis of amino acids
    CLH_2812 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLH_2812 (tpiA)
   00051 Fructose and mannose metabolism
    CLH_2812 (tpiA)
   00562 Inositol phosphate metabolism
    CLH_2812 (tpiA)
Enzymes [BR:cbt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CLH_2812 (tpiA)
Exosome [BR:cbt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CLH_2812 (tpiA)
  Exosomal proteins of bladder cancer cells
   CLH_2812 (tpiA)
  Exosomal proteins of melanoma cells
   CLH_2812 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2982647..2983393)
Genome map
AA seq 248 aa AA seqDB search
MRKAIIAGNWKMNKTVDEAVKVVEELKPLVKDATCDVVVCPTFVCLDAVKKATAGSNIKV
AAQNMHFEESGAFTGEVSPGMLEAMGIEYVVLGHSERREYFNETDEAINKKVKAAFAHNI
TPIVCCGETLEQRESGVTNNFIACQIKVDIAGLTKEQAEKVVIAYEPIWAIGTGKTATKE
QANETILAIRNVVVEMYGKEVADKVRIQYGGSVKPNTITEQMAMSDIDGALVGGASLKAE
DFSGIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcaattattgcaggaaactggaaaatgaataaaactgttgatgaagcagtt
aaagttgtagaagaattaaaaccattagttaaggatgctacttgtgatgtagttgtatgt
cctacatttgtatgtttagatgctgttaaaaaagcaacagctggatcaaacataaaagtt
gcagctcaaaacatgcattttgaagaaagtggcgcattcacaggagaagtttctccagga
atgttagaagctatgggaattgaatatgttgttttaggacacagtgaaagaagagaatac
ttcaatgaaactgatgaagcaataaataaaaaggttaaagcagcatttgctcacaacatt
actccaatagtttgttgtggagaaactttagaacaaagagaaagcggagttactaataac
tttatcgcttgccaaattaaagttgatattgctggattaactaaagaacaagctgaaaaa
gttgttatagcttatgaaccaatctgggctattggaactggtaaaactgctactaaggaa
caagctaatgaaacaatattagcaatcagaaacgttgtagtagaaatgtacggtaaagaa
gttgctgataaagtaagaattcaatacggtggatcagttaaaccaaatacaatcactgaa
caaatggctatgtctgatatagatggagcattagttggtggagctagtttaaaagcagag
gatttctctggaatagttaactactaa

DBGET integrated database retrieval system