KEGG   Clostridium botulinum E3: CLH_2921Help
Entry
CLH_2921          CDS       T00767                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cbt  Clostridium botulinum E3
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cbt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CLH_2921 (galU)
   00052 Galactose metabolism
    CLH_2921 (galU)
   00500 Starch and sucrose metabolism
    CLH_2921 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CLH_2921 (galU)
Enzymes [BR:cbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CLH_2921 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3104915..3105787)
Genome map
AA seq 290 aa AA seqDB search
MKVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVASGIEEILIITGRNK
KCIEDHFDKSIELEFELEKSGKEELLELVRNISDMVDIHYIRQKEPKGLGHAIHCAKTFV
GNEPFAVLLGDDVVDSETPCLKQLIDCFSEYNTTILGVQTVAEENVSKYGIVDGLHIEDR
VYKVKDLVEKPSVEEAPSNVAILGRYIITPEIFNILENTKPGKGGEIQLTDALKTLISKE
AMYAYNFEGRRYDVGDKLGFLQATVEFALKREELREPFIEYLKGNPWDEK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaaaaaagcgattattccagcagctgggctaggaacaagatttttaccagca
actaaggcacaaccaaaggaaatgcttcctatagttgataaaccaacaattcaatacata
attgaagaagcagttgcatcaggaatagaagaaatacttattataacaggaagaaataaa
aagtgtatagaagatcactttgataaatctatagaattagagtttgaattagagaagtca
ggaaaagaagaacttttagagttagtaagaaatatttctgatatggttgatatacattat
attagacaaaaagaacctaaaggtttaggtcatgcaattcattgtgcaaaaacatttgta
ggtaatgaaccttttgcagttttattaggtgatgatgttgttgatagtgaaacaccatgt
ttaaaacagttaatagattgttttagtgaatacaatactactattttaggagttcaaact
gtagcagaagaaaacgtatcaaaatacggaattgttgatggactacatatagaagataga
gtctataaagtaaaggatttagttgagaagccatcagtagaagaggcacctagcaatgta
gctattttaggaagatatattataacacctgaaatatttaatatattagaaaatacaaaa
ccaggaaaaggtggagaaattcaattaactgatgcattaaagactttaattagtaaagaa
gcaatgtatgcttataattttgaaggcagaagatatgatgtaggagataagcttggattt
ttacaagcaacagtagaatttgcattaaaaagagaagaattaagagaaccttttatagaa
tatttaaaaggtaatccatgggatgaaaaataa

DBGET integrated database retrieval system