KEGG   Clostridium botulinum E3: CLH_3087Help
Entry
CLH_3087          CDS       T00767                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cbt  Clostridium botulinum E3
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cbt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLH_3087 (pfkA)
   01230 Biosynthesis of amino acids
    CLH_3087 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLH_3087 (pfkA)
   00030 Pentose phosphate pathway
    CLH_3087 (pfkA)
   00051 Fructose and mannose metabolism
    CLH_3087 (pfkA)
   00052 Galactose metabolism
    CLH_3087 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CLH_3087 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CLH_3087 (pfkA)
Enzymes [BR:cbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLH_3087 (pfkA)
Protein phosphatases and associated proteins [BR:cbt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CLH_3087 (pfkA)
Messenger RNA biogenesis [BR:cbt03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CLH_3087 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3327893..3328855)
Genome map
AA seq 320 aa AA seqDB search
MKKIAILTSGGDAPGMNAAIRAVVRTAIDKGLEVMGVQRGYSGLLNGELFAMNRTSVSDI
IQRGGTILRTARCPEFKDEEVRKRAVKILNAYGVDALVVIGGDGSFMGAKLLSKLGIKTI
GLPGTIDNDLAYTDFTIGFDTALNTIVDAINKIRDTSTSHERVSIIEVMGRDCGDLALHA
GISSGAEAIIVPEMGEFDRDALCRTILEGKNHGKTHSIVILAEGIGGAEELSKYVQELTG
IEARATILGHIQRGGAPSASDRVLASRLGARAVEVLLQGETSRVIGIRDNQIIDQDIDEA
LAMESKFDLDLYNVAEVLSR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatagctattttaacaagtggtggagatgccccaggaatgaatgccgctata
agagcagtagtaagaacagccattgataaaggccttgaagttatgggcgttcaaagaggc
tacagtggattacttaatggtgagctatttgcaatgaatagaacatcagtatctgatatt
attcaaagaggtggaacaatcctaagaactgctagatgcccagagttcaaagacgaagag
gtaagaaaaagagcagttaaaatattaaatgcttatggtgtagatgctttagttgttatt
ggtggagatggatcttttatgggagccaaattactatcaaaactaggaatcaaaactata
ggattaccaggaacaatagataatgatttagcttatactgattttacaataggatttgat
acagcattaaatactattgttgatgcaataaataaaataagagatacatcaacttctcat
gaaagagtttcaataattgaagttatgggaagagattgtggagacttagctcttcatgct
ggtatctcaagtggagcagaagctataatagttccagaaatgggtgaattcgatagagat
gcgctttgcagaactatattagaaggtaaaaaccatggaaaaactcatagcatagttatt
cttgcagaaggaattggtggagcagaagaactatcaaaatatgttcaagaattaacagga
atagaagcaagagctacaatattaggtcatatccaaagaggtggagcaccatctgcatca
gatagagttttagcttcaagattgggagctagagcagtagaagttcttttacaaggagaa
acttcaagagtaataggaattagagataatcaaattatagaccaagatatagatgaagcg
ttagctatggaaagtaagtttgatttagatctatataatgtagcagaagtattatcacgc
taa

DBGET integrated database retrieval system