KEGG   Clostridium botulinum E3: CLH_3146Help
Entry
CLH_3146          CDS       T00767                                 

Definition
(GenBank) putative glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cbt  Clostridium botulinum E3
Pathway
cbt00010  Glycolysis / Gluconeogenesis
cbt00052  Galactose metabolism
cbt00500  Starch and sucrose metabolism
cbt00520  Amino sugar and nucleotide sugar metabolism
cbt00521  Streptomycin biosynthesis
cbt01100  Metabolic pathways
cbt01110  Biosynthesis of secondary metabolites
cbt01120  Microbial metabolism in diverse environments
cbt01130  Biosynthesis of antibiotics
cbt01200  Carbon metabolism
Module
cbt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cbt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cbt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLH_3146
   00052 Galactose metabolism
    CLH_3146
   00500 Starch and sucrose metabolism
    CLH_3146
   00520 Amino sugar and nucleotide sugar metabolism
    CLH_3146
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CLH_3146
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CLH_3146
Enzymes [BR:cbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CLH_3146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: ACD52908
Position
complement(3389606..3390559)
Genome map
AA seq 317 aa AA seqDB search
MQKFVVGVDLGGTKISTALSNLNGEVISQTTVPTNAHEGEIPVLNRIIDSVDKVIKDGGV
TYKDVKAIGIGSPGPLDAEKGVIIYTPNLPFKNFNLVDPLNKKFEVPVFLDNDANVATIG
EFMFGAGRGAKNVLFFTVSTGVGGGAILDGKIYRGHTSNALEIGHMTVAPDGPRCNCGNI
GCVEATSSGTAIGKRGKEAIGSKVETSLRKYDEITSYEVFVEAAAGDPVCKDIIDNALNY
LGIAVANSVSIFDPEVIIIGGGVSKAGNIVFDTVRKVVDKRCFKSMAESVKIVPAGLGTD
AGVVGAVALALLETSEK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatttgtagtaggggttgacttaggaggaactaagataagtacagctttatca
aatttaaatggtgaagttattagccaaacaacagttccgactaatgcacacgagggagaa
attccagtattaaatagaataatagactcagtagataaggtaataaaagatggtggagtt
acttataaagatgtaaaagcaataggtattggttctccaggaccacttgatgcagaaaag
ggagtaataatatatacacctaatcttccatttaaaaactttaatttagtagacccacta
aataaaaagtttgaagtacctgttttcttagacaatgatgcaaacgttgctactattggt
gaatttatgtttggagcaggaagaggtgctaaaaacgtattattctttacagtaagcaca
ggcgtaggtggtggagctatattagatggaaaaatatatagaggccatacatcaaatgca
ttagaaataggtcatatgactgtagcacctgatggtccaagatgtaattgtggaaatatc
ggttgtgtagaagcaacttcatcaggaacagctataggtaaaagaggaaaagaagctata
ggaagtaaagttgaaacatcattaagaaaatatgatgaaataacttcatatgaagtattt
gtagaagcagctgctggagatccagtatgtaaagatataatagataatgcattaaattat
ttaggaatagctgttgcaaattctgtatcaatttttgatccagaagtaataataattggt
ggaggcgtttcaaaagctggaaatattgtatttgatacagtaagaaaagttgtagataag
agatgctttaaatcaatggctgaatcagttaagattgtaccagcaggacttggaacagat
gcaggtgttgtaggagcagtagctttagcattacttgaaacttcagaaaaataa

DBGET integrated database retrieval system