KEGG   Clostridium botulinum E3: CLH_3228Help
Entry
CLH_3228          CDS       T00767                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cbt  Clostridium botulinum E3
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cbt00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cbt00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3490478..3490972
Genome map
AA seq 164 aa AA seqDB search
MLSIIVAIAKNNVIGNDNKLIWHISEDLKRFKEITSGKTIVMGRKTFESLPGVLPNRKHI
ILTRDKNFKVNSECVEIIYDFDELLNKYKNSDTEVFIIGGGEIYKQLLPHTNKLYLTKIN
KDFDGDTYFPQINYDDFKVDYKSDIITDEKSKLEYNFINLSRLS
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgttatccataatagtagctattgctaaaaataatgttattggaaatgataataaatta
atttggcatatttctgaagacttaaaaagatttaaagaaattaccagtggaaaaactatt
gtaatgggaagaaaaactttcgagtctcttcctggagtattacccaatagaaaacatatt
attttaactagagataaaaattttaaagttaactctgaatgtgtggaaataatttatgat
ttcgatgaattattaaataaatataaaaattctgatactgaagtatttataattggtggt
ggagaaatttataaacagctattaccacatactaataaactgtacttaacaaagataaac
aaagattttgatggagatacttattttccacaaataaattatgatgattttaaagtagat
tataaatcagatattataactgatgaaaaaagcaaattagaatataactttataaattta
agtagactatcttag

DBGET integrated database retrieval system